KEGG   Listeria ivanovii: LIV_0505Help
Entry
LIV_0505          CDS       T01623                                 

Gene name
xylA
Definition
putative xylose isomerase
Orthology
K01805  
xylose isomerase [EC:5.3.1.5]
Organism
liv  Listeria ivanovii
Pathway
Pentose and glucuronate interconversions
Fructose and mannose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Pentose and glucuronate interconversions [PATH:liv00040]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:liv00051]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
545743..547056
Genome map
AA seq 437 aa AA seqDB search
MSYFPQVEKIQFEGKDTKNRLAFRHYQADEVVLGKPMKEHLRFAVAYWHTMTQDGSDPFG
MATNERTWIGQTEMETAKNRVEAFFEILEKLGVEYFCFHDIDVAPAGDSIKDFMNNLDEI
TDLIRVKMDETGIKLLWNTANMFSHPRFNNGAGSTNDPEVFAYAAAQVKKGLDISKKLGG
ANYVFWGGREGYETLLNTDMKFEQDNIARLFKMVVAYAEKIGHKPQFLIEPKPKEPSKHQ
YDFDAATTMAFIQKYGLAGDFKLNLEANHATLAGHTFEHELRVARDYNALGSIDANQGDM
LLGWDTDEFPTNVVDVTLAMYEILQNGGIAPGGINFDAKVRRSSFAMEDLLLAHIAGMDT
FARGLKAAAKLTEDKFIENILRERYGKWVDTEIGKSILENKEDLESLSKYAYQHGDDIQL
KSSHIEHVKSVLNDYIF
NT seq 1314 nt NT seq  +upstreamnt  +downstreamnt
atgagctattttccacaagtagaaaaaattcaatttgaaggtaaggatacgaaaaaccgc
ttggcatttcggcattatcaagcggacgaggtggttcttggaaaaccaatgaaagaacat
ttgcgttttgcagtagcttactggcatacgatgacacaagatggtagtgatccgttcggt
atggctacgaatgagcggacttggattggtcaaacagagatggaaacagcgaagaatcgt
gtggaagcattttttgaaattcttgaaaaattgggcgtggaatatttttgtttccatgat
attgatgtagcaccagcaggcgattctattaaggatttcatgaataacttagatgaaatt
actgatttaattagagtgaaaatggacgaaactggtattaaattactttggaacacagcg
aatatgttttctcatcctcgttttaataatggcgccggctcgacaaatgacccagaagtg
tttgcctatgcagcagcgcaagtgaaaaaagggctagacatctctaagaaactaggcgga
gcaaactatgtattttggggtggtcgcgagggttacgaaacgcttttaaacacggatatg
aaatttgaacaagacaacattgctcgtttatttaaaatggtggttgcctacgccgaaaag
attggtcataaaccgcaatttttaattgaaccaaaaccgaaagaaccgtccaaacatcaa
tatgattttgatgcggcaacaaccatggcatttatccaaaaatatggtttagcaggtgat
tttaagctgaatttagaagcaaaccatgccacacttgctgggcacacttttgaacatgaa
ttacgtgtagctcgtgattataacgctcttggttcaattgacgctaaccaaggagacatg
ttacttgggtgggataccgatgaatttccgacaaatgtcgttgatgtaacacttgcgatg
tatgaaattttacaaaatggtggaattgcgccaggtggcattaattttgatgcaaaagtg
agacgttcttcgtttgcgatggaagacttattacttgcgcatattgcagggatggacacg
ttcgcacgtgggttaaaagcagcagctaaattaacagaagataagtttatcgagaatatc
cttcgtgaacgctatggtaaatgggtggatacagagattggaaaatccattctagaaaac
aaagaggatttggaatcactatcgaaatatgcgtatcaacatggagatgatattcaactg
aaatctagccatatcgaacatgtaaaatcggtgttgaatgattatatcttttaa

DBGET integrated database retrieval system