KEGG   Listeria ivanovii: LIV_0826Help
Entry
LIV_0826          CDS       T01623                                 

Definition
putative protoporphyrinogen IX and coproporphyrinogen III oxidase HemY-like protein
Orthology
K00231  
oxygen-dependent protoporphyrinogen oxidase [EC:1.3.3.4]
Organism
liv  Listeria ivanovii
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:liv00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
887824..889203
Genome map
AA seq 459 aa AA seqDB search
MKHIVIIGGGLSGLAAAYELQKTHPNYTWELVEKDEKLGGKFETVKRDGFLIEKGPDSFL
ARKPAGIELVRELGLENQLIANATGHSYIYHQKALHPIPEGSVMGIPTNKQALLASTLIS
EVGKARALQEPTIPANTTKADQSIGDFFEVRFGKELVKTLIEPLLSGIYAGDIYKMSLRA
TFPQFEEAVAKHGSLMEGLQQNQLNTTGTKATIGAFRTLDGGLEALPKAVEQALPKNHLH
TGKQATQILKKGHSYEIFFENGDKISADGVIIAATHDTLIDLLGARVTEPFANQPLTSLA
TVSLAYNESDVPILPDGTGYLVARTAPYRTTACTWVQKKWPHMVPENKMLLRGFVGKAGE
TWLEEASDEAIISAVLADYAEMMDIERAPLFYEVSRMKSAMPQYLVTHQARLKQLKENIA
TDYPGIYFAGMSYQGVGIPDCIAGAKLAVNDVTDFLKEV
NT seq 1380 nt NT seq  +upstreamnt  +downstreamnt
gtgaaacatattgtgattatcggaggcggcttatcggggcttgcagcagcttatgaacta
caaaaaacacatccgaattatacgtgggaattagtagaaaaagacgaaaaattaggcggg
aaattcgaaacagttaaacgagacggctttttaattgaaaaaggaccagattctttttta
gcgagaaagccagccggaatcgaattagtgagagagctaggattagaaaatcaattaatt
gcgaatgcaactgggcattcttatatttaccatcaaaaagcgctacatcctattccagaa
gggtcagtgatgggcattccaacgaacaaacaagcactattagcaagcacgcttatttca
gaagtagggaaagctcgtgccttacaagaaccaaccatcccagcaaacacaacaaaagca
gatcaatcgattggggacttttttgaagttcgttttggaaaagaactagtaaaaacgctt
atagagccacttttatctggtatttatgcaggagatatttataaaatgagcttgcgggca
acatttccgcaatttgaagaagcagtggctaaacacggtagtttgatggaaggcctgcaa
caaaaccagctgaacacgaccggaaccaaagcaactattggtgcattcaggacgctagat
ggcgggctagaagctttaccaaaagcagttgaacaagctcttcctaagaaccatttgcac
acaggaaaacaagcaacgcaaattttgaaaaaaggtcattcttatgaaattttttttgaa
aatggagataaaatatctgctgatggcgtcattattgctgctactcacgatacattaatt
gatttacttggagccagggtaacagaaccgtttgccaaccagccattaaccagccttgca
acagtctcattagcttataatgaaagtgatgtacccattttaccggatggaacgggttat
ttagttgctagaactgctccttatcgaaccactgcttgtacatgggtgcaaaaaaaatgg
ccacatatggtacctgaaaataaaatgctactacgaggttttgttggtaaagcaggtgaa
acttggttagaagaggcaagtgatgaagcaattatttctgctgttttagcagattatgcc
gaaatgatggatatcgaaagagcgccacttttttatgaagtaagtcggatgaagtctgca
atgccacagtatttagtgacacaccaagctagactaaaacaactaaaagaaaatattgcg
acagactacccgggaatttattttgcaggaatgagttatcaaggtgttggaattcctgat
tgtattgctggggcgaaactagctgttaatgacgttactgattttttgaaagaggtgtaa

DBGET integrated database retrieval system