KEGG   Listeria ivanovii subsp. ivanovii PAM 55: LIV_0826Help
Entry
LIV_0826          CDS       T01623                                 

Definition
putative protoporphyrinogen IX and coproporphyrinogen III oxidase HemY-like protein
Orthology
K00231  
oxygen-dependent protoporphyrinogen oxidase [EC:1.3.3.4]
Organism
liv  Listeria ivanovii subsp. ivanovii PAM 55
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:liv00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    LIV_0826
Enzymes [BR:liv01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     LIV_0826
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
887824..889203
Genome map
AA seq 459 aa AA seqDB search
MKHIVIIGGGLSGLAAAYELQKTHPNYTWELVEKDEKLGGKFETVKRDGFLIEKGPDSFL
ARKPAGIELVRELGLENQLIANATGHSYIYHQKALHPIPEGSVMGIPTNKQALLASTLIS
EVGKARALQEPTIPANTTKADQSIGDFFEVRFGKELVKTLIEPLLSGIYAGDIYKMSLRA
TFPQFEEAVAKHGSLMEGLQQNQLNTTGTKATIGAFRTLDGGLEALPKAVEQALPKNHLH
TGKQATQILKKGHSYEIFFENGDKISADGVIIAATHDTLIDLLGARVTEPFANQPLTSLA
TVSLAYNESDVPILPDGTGYLVARTAPYRTTACTWVQKKWPHMVPENKMLLRGFVGKAGE
TWLEEASDEAIISAVLADYAEMMDIERAPLFYEVSRMKSAMPQYLVTHQARLKQLKENIA
TDYPGIYFAGMSYQGVGIPDCIAGAKLAVNDVTDFLKEV
NT seq 1380 nt NT seq  +upstreamnt  +downstreamnt
gtgaaacatattgtgattatcggaggcggcttatcggggcttgcagcagcttatgaacta
caaaaaacacatccgaattatacgtgggaattagtagaaaaagacgaaaaattaggcggg
aaattcgaaacagttaaacgagacggctttttaattgaaaaaggaccagattctttttta
gcgagaaagccagccggaatcgaattagtgagagagctaggattagaaaatcaattaatt
gcgaatgcaactgggcattcttatatttaccatcaaaaagcgctacatcctattccagaa
gggtcagtgatgggcattccaacgaacaaacaagcactattagcaagcacgcttatttca
gaagtagggaaagctcgtgccttacaagaaccaaccatcccagcaaacacaacaaaagca
gatcaatcgattggggacttttttgaagttcgttttggaaaagaactagtaaaaacgctt
atagagccacttttatctggtatttatgcaggagatatttataaaatgagcttgcgggca
acatttccgcaatttgaagaagcagtggctaaacacggtagtttgatggaaggcctgcaa
caaaaccagctgaacacgaccggaaccaaagcaactattggtgcattcaggacgctagat
ggcgggctagaagctttaccaaaagcagttgaacaagctcttcctaagaaccatttgcac
acaggaaaacaagcaacgcaaattttgaaaaaaggtcattcttatgaaattttttttgaa
aatggagataaaatatctgctgatggcgtcattattgctgctactcacgatacattaatt
gatttacttggagccagggtaacagaaccgtttgccaaccagccattaaccagccttgca
acagtctcattagcttataatgaaagtgatgtacccattttaccggatggaacgggttat
ttagttgctagaactgctccttatcgaaccactgcttgtacatgggtgcaaaaaaaatgg
ccacatatggtacctgaaaataaaatgctactacgaggttttgttggtaaagcaggtgaa
acttggttagaagaggcaagtgatgaagcaattatttctgctgttttagcagattatgcc
gaaatgatggatatcgaaagagcgccacttttttatgaagtaagtcggatgaagtctgca
atgccacagtatttagtgacacaccaagctagactaaaacaactaaaagaaaatattgcg
acagactacccgggaatttattttgcaggaatgagttatcaaggtgttggaattcctgat
tgtattgctggggcgaaactagctgttaatgacgttactgattttttgaaagaggtgtaa

DBGET integrated database retrieval system