KEGG   Listeria ivanovii subsp. ivanovii PAM 55: LIV_0859Help
Entry
LIV_0859          CDS       T01623                                 

Definition
putative beta-glucosidase
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
liv  Listeria ivanovii subsp. ivanovii PAM 55
Pathway
Glycolysis / Gluconeogenesis
Brite
KEGG Orthology (KO) [BR:liv00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LIV_0859
Enzymes [BR:liv01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.86  6-phospho-beta-glucosidase
     LIV_0859
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
916755..918206
Genome map
AA seq 483 aa AA seqDB search
MFENYKFPKDFLWGGAIAANQAEGAFQVDGKGISLADLHKYHTDKTNEEISDEQHKGVSL
AEIKANIADKTSYYPKRHGIDFYHTYPEDLALLAEMGFKTFRTSIDWTRIFPTGEEDEPN
EAGLKYYDHLIDKIIELGMEPIITILHYETPVDIVLKHGGWRNRKVIDLFVKYGKTVLDR
YSQKVKYWIVINQINLIQFEPFNSTAIPNDAADDYLSATYQAVHNQFVASAQIYEYGKTI
NPEFMIGTMLADCTAYPYSCDPDDIVLAMKRNRMEYFYADVAFQGEYPQYALNYFDENGI
KVEITPEDKALLSKNTMDYLALSYYYSQMVDSKKNDLDPASITPNPHLKANPWGWAVDPK
GLYNALSQYWDRYHKPIIIAENGFGMYDKLEHGEVNDDYRIDYLSAHLKEMKRAMYDGVE
VIAYCAWGPIDIVSCSSAQMEKRYGFIYVDLDNEGKGTGKRIKKKSFSWYKKVIASNGQD
LEA
NT seq 1452 nt NT seq  +upstreamnt  +downstreamnt
atgtttgaaaattacaagtttccgaaagatttcctttggggaggagccattgctgcaaat
caggcagaaggtgcatttcaagtagatggcaaaggaattagtctagcagatttacacaaa
taccatacagataaaaccaacgaagagattagtgatgaacagcataaaggagttagttta
gctgagataaaagcaaatattgcagataaaacaagttattatccgaaacgtcacggtatt
gatttttatcatacctatccagaagatttggcattacttgctgaaatgggattcaaaaca
ttccgtacgtcaatcgattggacgcggattttccctacaggtgaagaagacgagccaaac
gaagcaggtttaaaatactatgatcatttaatcgataaaatcatcgaacttggcatggaa
ccaatcattactatcttacattacgaaactcctgtcgacattgtcttaaagcatggcgga
tggcgcaatcgtaaagtcatcgatttattcgttaaatatggtaaaaccgtattggatcga
tatagccaaaaagtaaaatattggattgttatcaaccaaattaatttaattcaattcgag
ccattcaactcaacagcgattccaaatgatgcagcggatgattatttatccgcgacatat
caggcggttcacaatcaattcgtagcaagcgcacaaatttatgaatacggcaagacaatt
aatccagagttcatgataggaacgatgcttgctgattgtacagcatatccatattcttgt
gacccagatgatatcgtcctagcaatgaaacgcaatcggatggaatacttctatgccgat
gtagcattccaaggtgaatatccgcagtacgctttaaactatttcgatgagaacggaatt
aaagtagaaatcacacccgaagataaagcacttttaagtaagaatacgatggactattta
gctttatcttactattattctcaaatggtagattctaagaaaaatgacttagacccagca
tcaattacaccaaatccacatttaaaagcaaatccatggggctgggctgttgatccaaaa
ggcttatacaatgctttgtcacaatactgggatagataccacaaaccaattatcatagcc
gaaaatggtttcggaatgtacgacaaactagaacacggagaagtaaatgacgattaccga
attgattacttatcagctcatctaaaagaaatgaaacgtgcgatgtatgatggtgtcgaa
gtaattgcctactgtgcttggggaccaatcgatattgttagctgttcctccgcgcaaatg
gaaaaaagatatggcttcatttatgttgatttggataatgaaggaaaaggtacaggcaaa
agaattaaaaagaaaagtttttcgtggtataaaaaagtaatagcatctaatgggcaagat
ttagaagcatga

DBGET integrated database retrieval system