KEGG   Listeria ivanovii subsp. ivanovii PAM 55: LIV_0928Help
Entry
LIV_0928          CDS       T01623                                 

Definition
putative glutathione peroxidase
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
liv  Listeria ivanovii subsp. ivanovii PAM 55
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:liv00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    LIV_0928
  Metabolism of other amino acids
   00480 Glutathione metabolism
    LIV_0928
Enzymes [BR:liv01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     LIV_0928
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
983106..983582
Genome map
AA seq 158 aa AA seqDB search
MNVHDFSEKAMNGKDISLKDYKGKVLLIVNTASKCGLTPQLEGLEAMYKKLGGEHFEILG
FPCNQFLRQDPGSDEAILEFCQMNYGVTFQMFSKIKVKGKDATPLYQYLTEQTGGKKVEW
NFAKFLIDENGDVVERFPSKMKPEDFEDKVEALVASVK
NT seq 477 nt NT seq  +upstreamnt  +downstreamnt
atgaatgttcacgatttttctgaaaaagcgatgaatggcaaagatatttcgcttaaagat
tataaaggaaaagtgctattaattgtcaacactgctagtaaatgtggtttaacaccgcag
ctagaaggactcgaagcgatgtacaaaaaacttggtggcgaacattttgagatccttggt
tttccctgtaatcaatttttgcgtcaagaccctggcagcgatgaagctattttggaattt
tgccaaatgaattatggtgtaaccttccaaatgttttcaaaaataaaagtaaaagggaag
gatgctactccactctaccaatatttaacagaacaaactggtggaaagaaagtggaatgg
aattttgctaaatttttaattgatgaaaacggggatgtggttgaacgtttcccttcaaaa
atgaaaccagaagattttgaggataaagttgaggcactggttgcaagtgtaaaataa

DBGET integrated database retrieval system