KEGG   Listeria ivanovii subsp. ivanovii PAM 55: LIV_1025Help
Entry
LIV_1025          CDS       T01623                                 

Definition
(GenBank) Putative UDP-glucose pyrophosphorylase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
liv  Listeria ivanovii subsp. ivanovii PAM 55
Pathway
liv00040  Pentose and glucuronate interconversions
liv00052  Galactose metabolism
liv00500  Starch and sucrose metabolism
liv00520  Amino sugar and nucleotide sugar metabolism
liv01100  Metabolic pathways
liv01130  Biosynthesis of antibiotics
Module
liv_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:liv00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    LIV_1025
   00052 Galactose metabolism
    LIV_1025
   00500 Starch and sucrose metabolism
    LIV_1025
   00520 Amino sugar and nucleotide sugar metabolism
    LIV_1025
Enzymes [BR:liv01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     LIV_1025
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 Glycos_transf_2 IspD Smr
Motif
Other DBs
NCBI-ProteinID: CBW85510
UniProt: G2ZEK3
Position
complement(1083774..1084661)
Genome map
AA seq 295 aa AA seqDB search
MKVKKAVIPAAGLGTRFLPATKAMPKEILPIVDKPTIQYIVEEAVESGIEDILIVTGKGK
RAIEDHFDSVPELESNLREKNKLELLHLIEETTNINLHFIRQSKPKGLGDAILQARGFVG
NEPFIVMLGDDIVQAKTPCAKQLIQQYEKTHSSIIGVQTVPHEDTYRYGIIDPIDEYSKD
LYNVNGFVEKPDPSSAPSDLAILGRYLLTPQIFDFLETQKPGAGGEIQLTDAINSLNEIQ
RVFAYDFEGERFDVGDKFGFIKTTMQFALKHPEIKDDVAKLVDQLYAEIHAKDKK
NT seq 888 nt NT seq  +upstreamnt  +downstreamnt
atgaaagtaaaaaaagcagttattccagcagcaggattagggactagatttcttccagct
acaaaagcaatgccaaaagaaattctgccaatcgtggacaaacccaccattcaatatatt
gtagaagaagctgttgagtcaggaattgaagatattctaattgttacaggtaaaggcaaa
cgagctatcgaggatcatttcgattctgttcctgagcttgaatccaatttacgtgaaaaa
aacaaattagaattactacatttaattgaagaaacaacgaatattaatcttcacttcatt
cgtcaatctaagcctaaaggccttggtgatgcgattcttcaagcaagagggtttgttggt
aatgagccatttatcgttatgttaggtgatgatattgttcaagccaaaacaccttgtgcg
aaacaattaatccaacaatatgaaaaaacacatagttctattatcggtgttcaaactgtc
cctcatgaagatacatatcgttatggtattattgatccaatcgatgagtacagcaaagac
ttatacaatgtcaatggttttgtagaaaagcctgatccaagctcagcgccatcagacctt
gctattctaggtcggtatttactaacaccacagatttttgattttcttgaaacacaaaaa
ccaggcgctggcggtgaaattcaactaactgatgctatcaacagtttaaatgagattcaa
cgcgttttcgcttatgacttcgaaggggaacgttttgatgttggcgataaatttggtttt
atcaaaacgaccatgcaatttgctttaaaacatccggaaattaaagatgatgtggccaaa
ttagtagatcagctttatgcagaaattcacgctaaagataagaaataa

DBGET integrated database retrieval system