KEGG   Listeria ivanovii subsp. ivanovii PAM 55: LIV_1025Help
Entry
LIV_1025          CDS       T01623                                 

Definition
putative UDP-glucose pyrophosphorylase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
liv  Listeria ivanovii subsp. ivanovii PAM 55
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:liv00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    LIV_1025
   00052 Galactose metabolism
    LIV_1025
   00500 Starch and sucrose metabolism
    LIV_1025
   00520 Amino sugar and nucleotide sugar metabolism
    LIV_1025
Enzymes [BR:liv01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     LIV_1025
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1083774..1084661)
Genome map
AA seq 295 aa AA seqDB search
MKVKKAVIPAAGLGTRFLPATKAMPKEILPIVDKPTIQYIVEEAVESGIEDILIVTGKGK
RAIEDHFDSVPELESNLREKNKLELLHLIEETTNINLHFIRQSKPKGLGDAILQARGFVG
NEPFIVMLGDDIVQAKTPCAKQLIQQYEKTHSSIIGVQTVPHEDTYRYGIIDPIDEYSKD
LYNVNGFVEKPDPSSAPSDLAILGRYLLTPQIFDFLETQKPGAGGEIQLTDAINSLNEIQ
RVFAYDFEGERFDVGDKFGFIKTTMQFALKHPEIKDDVAKLVDQLYAEIHAKDKK
NT seq 888 nt NT seq  +upstreamnt  +downstreamnt
atgaaagtaaaaaaagcagttattccagcagcaggattagggactagatttcttccagct
acaaaagcaatgccaaaagaaattctgccaatcgtggacaaacccaccattcaatatatt
gtagaagaagctgttgagtcaggaattgaagatattctaattgttacaggtaaaggcaaa
cgagctatcgaggatcatttcgattctgttcctgagcttgaatccaatttacgtgaaaaa
aacaaattagaattactacatttaattgaagaaacaacgaatattaatcttcacttcatt
cgtcaatctaagcctaaaggccttggtgatgcgattcttcaagcaagagggtttgttggt
aatgagccatttatcgttatgttaggtgatgatattgttcaagccaaaacaccttgtgcg
aaacaattaatccaacaatatgaaaaaacacatagttctattatcggtgttcaaactgtc
cctcatgaagatacatatcgttatggtattattgatccaatcgatgagtacagcaaagac
ttatacaatgtcaatggttttgtagaaaagcctgatccaagctcagcgccatcagacctt
gctattctaggtcggtatttactaacaccacagatttttgattttcttgaaacacaaaaa
ccaggcgctggcggtgaaattcaactaactgatgctatcaacagtttaaatgagattcaa
cgcgttttcgcttatgacttcgaaggggaacgttttgatgttggcgataaatttggtttt
atcaaaacgaccatgcaatttgctttaaaacatccggaaattaaagatgatgtggccaaa
ttagtagatcagctttatgcagaaattcacgctaaagataagaaataa

DBGET integrated database retrieval system