KEGG   Listeria ivanovii subsp. ivanovii PAM 55: LIV_1213Help
Entry
LIV_1213          CDS       T01623                                 

Gene name
proB
Definition
(GenBank) Putative gamma-glutamyl kinase
  KO
K00931  glutamate 5-kinase [EC:2.7.2.11]
Organism
liv  Listeria ivanovii subsp. ivanovii PAM 55
Pathway
liv00330  Arginine and proline metabolism
liv00332  Carbapenem biosynthesis
liv01100  Metabolic pathways
liv01130  Biosynthesis of antibiotics
liv01230  Biosynthesis of amino acids
Module
liv_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:liv00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    LIV_1213 (proB)
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    LIV_1213 (proB)
Enzymes [BR:liv01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     LIV_1213 (proB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AA_kinase OSK
Motif
Other DBs
NCBI-ProteinID: CBW85699
UniProt: G2ZFI1
Position
complement(1268304..1269134)
Genome map
AA seq 276 aa AA seqDB search
MRESLKNSKRLVIKVGTSTLMYGNGHINLRTIEKLAMVLSDLRNEGKEVILVSSGAIGVG
CHKLQLPIRPTSIPELQAVASVGQSELMHIYSKFFGEYGQVVGQVLLTRDVTDFPISREN
VMNTLESLLNRGIIPIVNENDTVAVEELEHITKYGDNDLLSAIVAKLVQADLLIILSDID
GFYETNPTTDPDAVMFSEINQITPEIEALAGGKGSEFGTGGMLTKLSAASYCIDGGQKMI
LTNGKNPAVIFDIMQGKPVGTLFASQKEEYSDDRTH
NT seq 831 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgaatctttaaagaatagtaagagattagtgatcaaagttggtactagtacatta
atgtatggaaatggccatattaatctacgtacgattgaaaaattagcgatggttttatcc
gatttacgtaatgaaggtaaagaagttattcttgtttcttccggagcaattggcgttggt
tgtcataaactacaactcccaattaggccaacaagtattcctgaactacaggcagtcgcc
tccgttggtcaaagtgaactaatgcatatttatagcaaattttttggtgagtatggacaa
gttgttggacaagtcttgcttacacgcgatgtgactgacttccctattagccgagaaaat
gtaatgaatacacttgaaagtcttttaaatagaggcattatcccgattgtaaatgaaaat
gacacagtcgctgtagaagaacttgagcatattactaaatatggtgataacgaccttctt
tctgctattgttgctaaacttgtacaggcagatttactgattatattgtctgatattgat
ggcttttatgaaacaaaccctacaactgatccagatgcagttatgttttctgaaatcaat
caaatcactcctgaaattgaggctctagctggaggaaaaggatctgaatttggaactggc
ggtatgttaacaaaactttctgctgcctcttattgtattgatggtggtcaaaaaatgatt
ttaactaatgggaaaaatcccgctgttattttcgatattatgcaaggcaaaccagtcggt
actttatttgctagccaaaaggaggaatattcagatgacagaactcattaa

DBGET integrated database retrieval system