KEGG   Listeria ivanovii: LIV_1268Help
Entry
LIV_1268          CDS       T01623                                 

Definition
putative deoxyxylulose 5-phosphate reductoisomerase
Orthology
K00099  
1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
liv  Listeria ivanovii
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of terpenoids and polyketides; Terpenoid backbone biosynthesis [PATH:liv00900]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1322420..1323562
Genome map
AA seq 380 aa AA seqDB search
MKKIILLGATGSIGTQTLTIVRDHPAEFQVVALSFGRNIERGRSIIQEFKPKMVAVWHSR
DKVTLEAEFPDVKVFSGLDGLREVATYPDGDTLLNAVMGSVGLLPTLDAIEAGKTIAIAN
KETLVTAGHLVMNAAREKNISLLPVDSEHSAILQALNGENPEKIKKIILTASGGSFRDKS
REQLSEVTVKEALKHPNWNMGNKLTIDSATMFNKGLEVMEAHWLFGVSYDQIEVVIQRES
IAHSMVQFIDGSFIAQLGTPDMRIPIQYALTYPDRFYIPFENEFQITDFSALHFEKVDYE
RFPALKLAYNAGKIGGTMPTVLNAANEIAVAGFLNGQVAFYNIEALVENAMNRHSSISNP
DLDTILQVDKETRAYVKTLL
NT seq 1143 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaattattttactgggagcaactggttcgattggtacgcaaacgttaacgatt
gtccgagatcatcctgctgaatttcaagtggttgctctgagttttggacgtaacatagaa
cgtggccgatcaattattcaagaatttaagccgaaaatggtggcagtgtggcactcacgt
gataaagtgacgcttgaagccgaatttccagatgtcaaagtttttagtggtttggatgga
ctaagagaagtggcaacttacccagatggcgacaccttattgaatgctgtcatggggagc
gtaggattattaccaactttagatgcgattgaagcaggaaaaactattgccattgccaat
aaagaaacactagtaacagcggggcatttggtaatgaatgcagcccgggaaaagaatatt
tcattattgccagtggatagtgagcattcggctattttacaagcattaaacggagaaaat
cctgaaaaaatcaagaaaattattcttacagctagtggtgggagttttcgtgataaatcg
cgggaacaattaagtgaagtcacggttaaagaagcactgaaacatcctaattggaatatg
ggaaacaaattaacgattgattctgcgacgatgtttaataaaggactagaggtaatggaa
gcgcactggttattcggtgtgagctatgatcagattgaggttgtcatccaacgtgaaagt
atcgcacactcgatggttcaattcatcgatgggagtttcattgctcaactaggaactcct
gatatgcgaattccgattcaatatgcgcttacttacccagatagattctatataccgttt
gaaaatgagttccagataacagatttttccgcacttcattttgaaaaagtggattatgaa
agatttccggcattgaaactcgcgtataatgctggtaaaataggtggaacaatgccgacc
gttttaaacgcagcaaatgaaattgctgtagctggatttttaaatggtcaagttgctttt
tataatatagaagcgcttgttgaaaatgcaatgaaccggcatagtagtatttcgaaccct
gatttggatactattttgcaggtagataaagaaactcgtgcgtatgtaaagacactttta
tag

DBGET integrated database retrieval system