KEGG   Listeria ivanovii subsp. ivanovii PAM 55: LIV_1465Help
Entry
LIV_1465          CDS       T01623                                 

Definition
putative exodeoxyribonuclease V
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
liv  Listeria ivanovii subsp. ivanovii PAM 55
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:liv00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    LIV_1465
Enzymes [BR:liv01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     LIV_1465
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1527597..1529990)
Genome map
AA seq 797 aa AA seqDB search
MAEQESLALFDTPEELFMKGTMLSTIFYNAENLFSVVRILVKETNADWDEKDIIVTGFFP
ALHEQEVYTFYGKMQEHAKFGQQFKAERFRKEMPQSRAGLINYLSGELFKGIGKVTAENI
VDTIGDDAITRILSDPSLLNNVPKLPSGAAESLLASLRENQGLEHVMVGLNEYGFGPQLS
MKIFQAYKQNAIEVLENNPYKLIEDVKGIGFHRADELGRKLGLGGNHPERLRAGILFMLD
SVCMQQGHVYMEQEALLAEVTFLLEESEGIRIDHAILMEQIEKLAEEQKIIMENTRVYMP
SLYYSESGFAYHVKRMLKQTQYQEQFPQSEFLLALGELEERIGVHYGDSQREALEQALMS
PMLVLTGGPGTGKTTVIKGIVELYAELNGVSLDPHAYKDGATFPVLLAAPTGRAAKRMSE
STGLPSMTIHRLLGMNGQEQMDDDAERLIDGRLLIVDEMSMVDIWLANQLFRALPSHMQV
VLVGDQDQLPSVGPGQVLKDILHSKQIPTVALSDIYRQKDGSSIIEMAHNIKEGMLPADF
AKNSADRSFFHCTVNQIGDVVEQVVKNAKNKGFRAKDIQVLAPMYRGPAGIDILNKKLQE
IFNPNDTGRRKEVQFGELKYRIHDKVLQLINQPEKNVFNGDIGEIVSIIYEKENTEKQDM
IVVQFDQTEVSYYRQEFNQLTHAYCCSIHKAQGSEFPIVIMPIVRSYYRMLRRDLLYTGV
TRSKQFLILCGEEEAFRMGVERVDENKRNTTLSERLISEDVMLEQMTNKRILTIENITEI
DPMIGMEGITPNQFMAG
NT seq 2394 nt NT seq  +upstreamnt  +downstreamnt
atggctgaacaagaatctctcgctttatttgacacgccagaagagctttttatgaagggc
acgatgttgtccaccattttttataatgccgaaaacctcttttctgttgtgcgaattctt
gtcaaagaaaccaatgcagattgggatgaaaaagatattattgtgactggttttttcccc
gctttacatgaacaagaagtgtatactttttatgggaaaatgcaggaacatgccaaattt
ggacagcaatttaaagcagaacgttttaggaaagaaatgccgcaatctcgtgctggttta
attaattatctgtctggtgagctttttaaaggtattggcaaagtgactgcggaaaatatt
gttgatacaattggcgacgatgcaattacgcggattttatctgatccaagtttacttaat
aatgttccaaagttaccatctggtgctgcggagagcctccttgcttctttacgagaaaat
caaggcttagagcatgtgatggtcgggctaaatgaatatggatttggtccacaactttcg
atgaagatttttcaagcatataaacaaaatgctatcgaagtacttgaaaacaatccatac
aaattaattgaggatgtcaaaggtattggatttcaccgagcggatgagcttggtcggaaa
ttaggactaggaggaaatcatcctgaacgccttcgtgcgggaattttatttatgcttgat
tctgtatgcatgcaacaaggccatgtttatatggaacaagaagcgctacttgcagaagtg
acctttttgctagaagaaagtgaaggtattcgaattgatcatgctattttaatggaacaa
atagaaaagcttgctgaagaacaaaaaattatcatggaaaacacacgtgtctatatgcca
tctttatattattcggaaagcggctttgcttatcatgtaaaacggatgctgaaacaaaca
cagtatcaagagcaatttccgcagtctgagttcttgctggcacttggagagttagaagag
cgaattggtgttcattacggagattcgcagcgagaggcgttagagcaagctttaatgtcg
ccgatgcttgtacttactggtggaccaggaacagggaagactactgttattaaaggtatt
gtggaattatatgccgaattaaatggtgtaagtctagacccgcatgcttataaagatggc
gcgacgtttccagttctgttagcggcaccaactggacgagcagctaagcgaatgtctgag
tcaacaggacttccatcaatgaccattcaccgtttactcggtatgaatgggcaagagcaa
atggatgatgatgcagaaagattaattgatggtcggcttttaattgtagatgaaatgtcg
atggtggatatttggcttgctaaccaactatttcgtgcacttccttcgcatatgcaagta
gttttagtaggagaccaagaccaattgccatcagttggaccaggacaggtcttgaaagat
atacttcactcgaaacaaattccaaccgttgcgctttcagatatttataggcaaaaagat
ggatcttccattattgagatggctcataatattaaagaaggcatgttgccagctgatttt
gcgaaaaatagtgctgatcgttctttctttcactgtaccgtgaatcaaattggtgatgtc
gttgaacaagtcgtaaaaaatgccaaaaataaaggtttccgcgcaaaagatattcaagtt
ttagcaccgatgtatcgtggcccggctggaatcgatattttaaataaaaagctacaagaa
atttttaatcctaatgacactggcagacgtaaagaagtgcaatttggcgaattaaaatat
cgtatacatgataaagttttgcagttaataaatcaaccggaaaaaaatgtctttaacggc
gatatcggggaaatagtatcgattatttatgagaaggaaaacaccgaaaagcaagatatg
attgttgtgcaatttgatcaaaccgaagtatcctattaccggcaagaatttaatcaattg
acgcatgcttattgttgttctattcataaagcacaaggtagcgagtttcccattgtgatt
atgccaattgttcgtagctattaccgaatgttacgacgtgacttgttatatacgggtgtc
actcgaagcaagcaatttttgattctttgcggtgaagaagaggcgtttcgaatgggtgtt
gagcgtgtcgatgaaaacaaacgtaatacgacgctttcagaacgtttaataagtgaagat
gttatgctcgaacaaatgaccaataaacgaattttaactatcgaaaatattaccgaaata
gatccgatgattgggatggaaggaataacccccaaccaatttatggcaggctaa

DBGET integrated database retrieval system