KEGG   Listeria ivanovii: LIV_1489Help
Entry
LIV_1489          CDS       T01623                                 

Gene name
ruvA
Definition
putative Holliday junction DNA helicase RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
liv  Listeria ivanovii
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:liv03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1556045..1556650)
Genome map
AA seq 201 aa AA seqDB search
MYDYIKGIITTITPEYIVVETGQIGYQIITGNPFSFQRLEGTETQVFLYQHVREDNISLF
GFQSTEERYLFKKLLSVSGIGPKSALAIIASGDVVPLITAIESEDDVYLTKFPSVGKKTA
RQIILDLKGKLADVVTSEIVYNAPENDIVSGLVPALEEAVLALEALGYSSRELKKVIPKL
VKEENLTSDAYIKLALKLMTK
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
ttgtacgattacataaaaggaattatcacgacgattacaccagaatatattgttgtcgaa
actggacaaattggttatcaaatcattacaggaaacccgttttcctttcagcgcttagaa
ggaacagagacacaagtatttttatatcaacatgttcgggaagacaatatttcgcttttt
ggctttcaatcaacagaagaacgttatttatttaaaaaattactaagtgtttctggaatt
gggcctaagagcgcgcttgctattattgcttccggggatgtggtgcctttaattaccgca
attgagtcagaagatgatgtctatttgacaaaatttccaagtgtaggcaaaaaaacagca
cgccaaattattcttgatttaaaagggaaattagcggatgtggtaacaagtgaaattgtt
tataatgcaccagaaaatgatatcgtcagtgggcttgtgccggcattagaagaagcggtt
ttagctttagaagcacttggttatagctctagagaattaaaaaaagtaataccaaaatta
gttaaagaagaaaacttaacgagtgatgcctatatcaagttagcactcaaattaatgaca
aaatag

DBGET integrated database retrieval system