KEGG   Listeria ivanovii subsp. ivanovii PAM 55: LIV_1494Help
Entry
LIV_1494          CDS       T01623                                 

Definition
putative glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
liv  Listeria ivanovii subsp. ivanovii PAM 55
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:liv00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    LIV_1494
Enzymes [BR:liv01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     LIV_1494
Exosome [BR:liv04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   LIV_1494
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1560972..1562465)
Genome map
AA seq 497 aa AA seqDB search
MEKKYILALDQGTTSSRAMIIDEEGEVIGVAQEEFDQIFPKPGWVEHSANEIWASILAVI
AGVLLKTNISSKEIAGIGITNQRETTVIWDKESGNPIYNAIVWQSRQTEDICKQLRKDGY
EDTIRSKTGLLIDPYFAGTKARWILDHVDGAQERAEKGELLFGTIDTWLVWKLTGGRAHI
TDYSNASRTLLYNIYDLEWDDELLKMLNIPKAMLPEVRPSSEVYANTVPYHFFGEEVPVA
GIAGDQQAALFGQGCFEKGMAKNTYGTGCFLLMNTGEKAVRSENGLLTTLAWGIDGKVEY
ALEGSIFVAGSAIQWLRDGLRMVRQSSDSENYASRIESTDGVYVVPAFVGLGAPYWDSDV
RGAVFGLTRGTEKEQFIRATLESLAYQTRDVLYAMEQDSGIKLKTLRVDGGASANNFLMQ
FQSDILGVPVERPENKETTVLGAAFLAGLAVGVWKDKSEIKKHWKLDNRFEVEMKEKERE
GLYEGWHRAVKAAQAFK
NT seq 1494 nt NT seq  +upstreamnt  +downstreamnt
atggaaaagaaatacattttggcactcgatcaaggaacaaccagctcaagagcgatgatt
attgatgaagaaggagaagtaattggcgttgcacaagaagaatttgatcaaatttttcct
aaaccaggttgggtagaacatagtgccaatgaaatttgggcttccattctagcggttatt
gctggtgtgttattaaaaacaaacatttcttctaaagaaattgcaggtattggtatcaca
aaccaacgtgaaacaacggttatttgggataaagaaagtggtaatccaatttataatgcg
attgtctggcaatctcgtcaaacagaagatatttgtaaacagcttcgaaaagatggatat
gaagatacaattcgttctaaaaccggacttttaattgatccgtattttgctggaacaaaa
gcacgttggattttagatcatgtggacggcgcacaagaacgtgcggaaaaaggcgagtta
ttatttggaacaattgatacgtggctagtttggaaattaaccggtgggcgtgctcatatt
acagactattccaatgcttcccgtacactgctttataatatttacgatttagaatgggat
gatgagcttctgaaaatgctaaatatcccgaaagcaatgttaccagaagttcgcccatcg
tcagaagtatacgcaaatacagttccctaccatttctttggtgaagaagttccggttgcg
ggtattgcaggcgatcaacaagctgccttattcggtcaaggctgttttgaaaaagggatg
gcgaaaaatacttatggaactggttgtttcttactaatgaacactggagaaaaagcagtg
cgttctgaaaacggattacttacaacgctagcatggggaattgatggtaaagtagagtat
gcattagaaggtagtatcttcgttgccggttctgctattcagtggttgcgtgatggttta
cggatggttcgtcaatcaagcgactctgaaaactatgctagtcgcattgagtctactgac
ggcgtttatgttgtaccagcatttgttggtctcggcgcaccttactgggattccgatgtt
cgaggcgcggtatttggtttaactcgtggtacggaaaaagaacaattcattcgtgcgaca
ttagaatcacttgcttatcaaacgagagacgtgctttatgcaatggaacaagattccgga
atcaaactaaaaacattgcgagttgacggtggggcttcagcaaataacttcctaatgcag
ttccaatcagatattttaggtgttccagttgaacgtccggaaaataaagaaacaacagta
ctcggagcagcattcttagcaggacttgctgtaggtgtttggaaagataaaagtgaaatt
aaaaaacactggaaactagataatcgcttcgaagtagaaatgaaagaaaaagaacgtgaa
ggcttatatgaaggctggcatagagctgtcaaagcagcacaagcattcaaataa

DBGET integrated database retrieval system