KEGG   Listeria ivanovii subsp. ivanovii PAM 55: LIV_1510Help
Entry
LIV_1510          CDS       T01623                                 

Gene name
hemB
Definition
putative delta-aminolevulinic acid dehydratase
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
liv  Listeria ivanovii subsp. ivanovii PAM 55
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:liv00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    LIV_1510 (hemB)
Enzymes [BR:liv01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     LIV_1510 (hemB)
Exosome [BR:liv04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   LIV_1510 (hemB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1578098..1579072)
Genome map
AA seq 324 aa AA seqDB search
MKNQFDRHRRLRKTSVMRDLVRETILHTDDLIYPIFVKDGKEPKTEVVSMPGVFQFPLHE
LKQEIKSIQNLGIKAVILFGIPAEKDAIGTQAYHDHGIIQEATRLIKTSFPEMLVVADTC
LCEFTDHGHCGVIQEGEILNDESLKLLQKTAISQASAGADIIAPSNMMDGFVQIIREGLD
EAGFQDIPIMSYAVKYASAFYGPFRDAAGSAPQFGDRKSYQMDPANREEALREAISDEQE
GADFLIVKPSLSYLDIMRDVKNNTRLPVVAYNVSGEYAMVKAAAQNGWIDEERIVLEMLT
SMKRAGASLIITYFAKDVSKYLNK
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaatcaatttgatagacatcgtcgtttaagaaaaacaagtgtgatgagagattta
gttagagaaaccattttacatacagatgatttaatttatcctatctttgtgaaagatgga
aaagagccaaaaacagaagtggtttctatgccaggagtttttcagtttccactccatgaa
ttaaaacaagaaattaagagcatccaaaatcttggtattaaagctgttattttatttggc
attccagcagaaaaagacgcaattggcacgcaagcttatcatgatcatggcattatccaa
gaagcaactcggctaatcaaaactagttttcctgaaatgcttgtagttgctgatacttgt
ttgtgcgaatttaccgatcatggtcactgtggagttattcaagagggagaaattttaaat
gatgaatcactaaaattactgcaaaaaacagcgatcagtcaagcttcggcaggggcagat
attattgctccctctaatatgatggatggttttgtacaaattattcgtgaaggacttgat
gaggcaggctttcaagatatcccgattatgtcatatgctgtgaaatatgcttctgctttt
tatggcccatttcgcgatgcagccggaagtgcaccacaatttggcgatagaaagtcttat
caaatggatccagctaatagggaagaagcccttcgtgaagcaatttctgatgagcaggaa
ggagcagattttttaattgtgaaaccttccttgtcttaccttgatattatgcgagatgtt
aaaaataatacccgcttaccagttgtagcctacaatgttagtggcgagtatgcaatggta
aaagctgctgcacaaaatggttggatagacgaagaacgtattgttttagaaatgttaaca
agtatgaaacgtgcaggagcatcactaattatcacttattttgcaaaagatgtgtctaaa
tacttaaataaatag

DBGET integrated database retrieval system