KEGG   Listeria ivanovii subsp. ivanovii PAM 55: LIV_1593Help
Entry
LIV_1593          CDS       T01623                                 

Gene name
trpA
Definition
putative tryptophan synthase subunit alpha
Orthology
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
liv  Listeria ivanovii subsp. ivanovii PAM 55
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:liv00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    LIV_1593 (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    LIV_1593 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    LIV_1593 (trpA)
Enzymes [BR:liv01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     LIV_1593 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1670857..1671633)
Genome map
AA seq 258 aa AA seqDB search
MTKTLTEKITKNPGNPAIVTYIMGGDGGLEHLEEQLLFLEESGVSAIEIGIPFSDPVADG
PVIQLAGLRALKEKISLEAILTQLATSKVQVPLIIMSYINPIFHLGIPKFVELLQETPVK
GLIIPDLPYEHQNLITPEINGTDIALIPLVSLTSPKERLAEIAEQAEGFIYAVTVNGTTG
VRSEFDTHIDEHLAYLKSISPVPVLAGFGVSSIAHVEKFAAICDGVIIGSKVVQMLHDKK
KTELGNFLQKAANVPIEI
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
atgactaaaacattaacggaaaaaatcactaaaaacccagggaatcccgccattgttact
tatattatgggcggagatggtggtttagaacatttagaagagcagttactattcctagaa
gaatcaggagtgagcgcgattgaaattggaattcctttttctgatccagtagcagatggg
ccggttattcaactggctggtttgcgcgctctaaaagaaaaaattagtttggaagcaatt
ttaacgcaattagctacaagtaaagttcaagttccactaattattatgagctatattaat
ccaatttttcatttaggaattcctaagtttgtcgaattgcttcaagaaacgcctgttaaa
gggctcattattcctgatttaccatatgaacatcaaaatctcatcaccccggaaatcaat
ggcactgatattgcacttatcccgctggtatcactcactagcccaaaagaacggctcgcg
gaaattgcggaacaagcagaaggatttatttatgctgtgacagtcaacgggacaacggga
gttagaagtgaatttgatacacatattgatgagcatttagcttatttaaaaagtattagc
ccggttccggtactagcaggatttggtgtttcatccatagcacatgtagaaaaatttgcg
gcaatttgtgatggcgttattatcgggagtaaagtggttcaaatgctacatgataaaaag
aaaacagagcttgggaactttttacaaaaggcagcaaatgttcctatcgaaatataa

DBGET integrated database retrieval system