KEGG   Listeria ivanovii subsp. ivanovii PAM 55: LIV_1594Help
Entry
LIV_1594          CDS       T01623                                 

Gene name
trpB
Definition
putative tryptophan synthase subunit beta
Orthology
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
liv  Listeria ivanovii subsp. ivanovii PAM 55
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:liv00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    LIV_1594 (trpB)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    LIV_1594 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    LIV_1594 (trpB)
Enzymes [BR:liv01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     LIV_1594 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1671626..1672828)
Genome map
AA seq 400 aa AA seqDB search
MNYKAPDENGFYGRFGGRFVPETLMKAVKELEEAYKVSKTDPAFQKELNYYLKEYVGRET
PLYFAEQLTAHAGGAKIYLKREDLNHTGAHKINNTIGQALLARQMGKQKVVAETGAGQHG
VATATVAALFNMECTIFMGEEDVKRQSLNVFRMELLGAKVVSVKAGSRTLKDAVNEALRF
WVANVEDTHYIMGSVLGPHPFPEIVRDYQSVIGTEARKQHLEVEGKLPEAIVACVGGGSN
AMGLFHPFVEDKAVQMHGVEAAGHGLETEFHAATITKGEIGILHGAMMDVLQDENGQILE
AFSISAGLDYPGIGPEHSFFRDIGRAEYHSVTDDEAVEAFQLLCRTEGIIPALESSHAIS
YAVKLAATMHPEESMIVCLSGRGDKDVNQLKERLEGKKND
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atgaattacaaggcccctgatgaaaatggcttttacggaagatttggtggaagatttgta
cccgaaacattgatgaaagcagtaaaagagctagaagaagcctataaagtttctaaaacg
gatccagcttttcaaaaagaattaaactactatttaaaagaatatgtcggtcgagaaaca
ccgctttattttgcagaacaattaaccgcacatgcaggtggagcaaagatttatttgaaa
cgagaggacttaaatcataccggtgcgcacaaaatcaataacactatcggccaagcattg
ttagcaagacaaatgggcaaacaaaaagtagttgcagaaacaggagccggacaacatggt
gttgcaactgcaacggtagcagcactattcaatatggaatgtactatttttatgggagaa
gaagatgtgaaacgacaatcgcttaatgtgttcagaatggaactacttggcgcaaaagta
gtaagtgtcaaagcgggaagtcgaacgctcaaagatgcagtaaatgaagctttacgattc
tgggtggcaaatgtagaagatactcattatattatgggatctgttcttggaccacatcca
tttccagaaattgttcgcgattatcaaagtgttatcgggaccgaagcacggaaacaacat
ttagaagtggaaggaaaactaccggaagcaattgttgcttgtgtgggtggtggaagtaat
gcaatggggttattccatccttttgtggaagataaagcggttcagatgcacggggttgaa
gcagctggacacggtctcgagacagaatttcatgctgcaacgattacgaaaggggaaatc
ggcattttgcacggtgcgatgatggatgttttacaagatgaaaatggtcaaattctcgaa
gccttctccatttcggcaggactagactacccgggaatcggaccagaacatagctttttc
cgagatatcggtcgggctgaataccattctgtaacagatgatgaggcagtagaagctttt
caattattatgtcgtacggaaggaattatcccagcactagaaagctcccatgcgattagc
tatgcagttaaactagctgctacaatgcacccagaagaaagcatgattgtatgtttatct
ggacgcggcgacaaagatgttaatcaattaaaagaacggttggaggggaaaaagaatgac
taa

DBGET integrated database retrieval system