KEGG   Listeria ivanovii subsp. ivanovii PAM 55: LIV_1596Help
Entry
LIV_1596          CDS       T01623                                 

Gene name
trpC
Definition
(RefSeq) putative indol-3-glycerol phosphate synthase
  KO
K01609  
indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
liv  Listeria ivanovii subsp. ivanovii PAM 55
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:liv00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    LIV_1596 (trpC)
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    LIV_1596 (trpC)
Enzymes [BR:liv01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     LIV_1596 (trpC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1673436..1674194)
Genome map
AA seq 252 aa AA seqDB search
MTFLEEILAQKALEVAEMPNEKLLKKRKTYSFYEFLKANTKEMQLISEVKRASPSKGEIN
MGVNPVTQAKAYEAAGAGMISVLTDPIFFKGSIEDLREVAQNVTIPVLCKDFIISEKQLI
RARNAGATVVLLIISALDSETLKALFNKALSLDLEVLVEVHDAEELAIAQKIGAQLIGIN
NRNLHTFEVDIAVSETLVEGFITDACFISESGFRNARDVARVKKHYNAVLVGEALMREKT
LEIAARKLKVRR
NT seq 759 nt NT seq  +upstreamnt  +downstreamnt
atgacatttttagaagaaattttagcgcaaaaagctttagaggtggccgagatgccaaac
gaaaagttgttaaaaaaacgcaaaacttattcattttatgagtttttaaaagccaatacg
aaggaaatgcaattaatttcagaggtgaaacgagcttccccgtcaaaaggagaaataaat
atgggtgtaaatccggtcacccaagcaaaggcttatgaagcagcaggtgctgggatgatt
tctgttttaacagatcccattttctttaaaggctccatagaagatttgcgagaagttgct
caaaatgtaactattccagtgttatgtaaagactttattattagcgaaaaacaattaatt
cgtgccagaaatgctggggcaactgtggtattgctaattatttcggcgctagactcggaa
acacttaaagcactttttaataaggctttgtcccttgatttggaagtattagtggaagta
catgatgcggaagagttagctatcgcacaaaaaattggtgcgcaattaattggaatcaac
aatcggaatttgcatacatttgaagtggatattgcggtgagtgagacgctcgtggagggt
tttatcacagatgcttgttttattagtgaatcaggatttaggaatgcaagagatgtcgca
cgagtgaaaaaacactataatgctgttcttgttggagaagcgcttatgcgagaaaagaca
ctagaaatagcggcaagaaagttgaaggtgagacgatga

DBGET integrated database retrieval system