KEGG   Listeria ivanovii subsp. ivanovii PAM 55: LIV_1600Help
Entry
LIV_1600          CDS       T01623                                 

Definition
putative alcohol-acetaldehyde dehydrogenase
Orthology
K04072  
acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
liv  Listeria ivanovii subsp. ivanovii PAM 55
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Pyruvate metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:liv00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    LIV_1600
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LIV_1600
   00620 Pyruvate metabolism
    LIV_1600
   00650 Butanoate metabolism
    LIV_1600
  Lipid metabolism
   00071 Fatty acid degradation
    LIV_1600
  Amino acid metabolism
   00350 Tyrosine metabolism
    LIV_1600
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    LIV_1600
   00626 Naphthalene degradation
    LIV_1600
Enzymes [BR:liv01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     LIV_1600
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     LIV_1600
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1678232..1680832
Genome map
AA seq 866 aa AA seqDB search
MAIKENAAQEVLEVQKVIDRLADNGQKALKAFENYDQEQVDNIVHAMALAGLDQHMPLAK
LAVEETGRGLYEDKCIKNIFATEYIWNNIKNNKTVGVINEDEQTGVIEIAEPVGVVAGVT
PVTNPTSTTLFKAIIAIKTRNPIIFAFHPSAQRCSSQAAKVVYDAAITAGAPEHCIQWVE
KPSLEATKQLMNHDKVALVLATGGAGMVKSAYSTGKPALGVGPGNVPAYIDKTAKIKRSV
NDIILSKSFDQGMICASEQAVIVDKEVAKEVKAEMEANNCYFVKGAEFKKLESYVINPEK
GTLNPDVVGKSPAWIANQAGFKVPEDTKILVAEIKGVGDKYPLSHEKLSPVLAFIEAANQ
AEAFDRCEEMLVYGGLGHSAVIHSTDKEVQKAFGIRMKACRIIVNAPSAQGGIGDIYNGF
IPSLTLGCGSYGKNSVSQNVSATNLLNVKRIADRRNNMQWFKLPPKIFFEKYSTQYLQKM
EGVERVFIVTDPGMVQFKYVDVVIEHLKKRGNDVSYQVFADVEPDPSDVTVYKGAELMKD
FKPDTIIALGGGSAMDAAKGMWLFYEHPEASFFGLKQKFLDIRKRTFKYPKLGGKAKFVA
IPTTSGTGSEVTPFAVITDKENNIKYPLADYELTPDVAIVDAQYVTTVPAHITADTGMDV
LTHAIESYVSVMASDYTRGLSIRAIELVFENLRDSVLKGDPDAREKMHNASALAGMAFAN
AFLGINHSLAHKIGPEFHIPHGRANAILMPHVIRYNALKPKKHALFPRYESFRADEDYAR
ISRIIGFPATTTEEGVKSLVDEIIKLGKDVGIDMSLKGQNVAKKDLDAVVDTLADRAFMD
QCTTANPKQPLVSELKEIYLEAYKGV
NT seq 2601 nt NT seq  +upstreamnt  +downstreamnt
atggcaattaaagaaaatgcggcccaagaagtattagaagttcaaaaagtgattgacaga
ttagcagacaatggacaaaaagcattgaaagcatttgaaaattacgaccaagaacaagta
gacaatatcgtacatgcgatggcgcttgccggacttgaccaacatatgccccttgcaaaa
ttagcagtagaagaaactggacgtggattatacgaagataaatgtattaaaaacatcttc
gcaacagaatatatttggaacaacattaaaaacaacaaaacagttggtgttattaatgaa
gatgaacaaacaggcgttatcgaaattgctgaaccagttggtgtggttgccggagttaca
cctgtaacaaaccctacctccactactcttttcaaagcaattatcgcaattaaaactcgt
aatccaatcatctttgctttccatccaagtgcacaacgttgttcatctcaagcagcaaaa
gttgtttatgatgcagcaatcacagctggagcaccagaacattgtatccaatgggttgaa
aaaccttcattagaagcaacaaagcaattaatgaaccacgataaagttgctttagttctt
gcaactggtggtgctggaatggttaaatcagcatactctactggtaaacctgcactaggt
gtcggcccaggtaacgtaccagcttacattgacaaaacagctaaaatcaaacgttctgta
aatgacattattctttctaaatcttttgaccaagggatgatttgtgcttctgaacaagca
gttatcgtggacaaagaagttgccaaagaagtaaaagcagaaatggaagctaacaattgt
tacttcgttaagggcgctgaattcaagaaattagaaagctatgtaatcaatcctgaaaaa
ggaacacttaatccagatgtagttggtaaatcccctgcatggattgctaaccaagccggt
tttaaagttccagaagatacaaaaattcttgttgctgaaattaaaggtgtaggcgacaaa
tacccactatctcatgaaaaacttagcccagttcttgcatttatcgaagcagctaaccaa
gcagaagcattcgatcgttgtgaagaaatgctcgtatacggaggccttggacactctgca
gttattcattcaactgataaagaagttcaaaaagcattcggtattcgtatgaaagcttgc
cgtatcatcgtaaacgcaccaagcgctcaaggaggtatcggtgacatttataacggcttc
atcccttccctaacgcttggttgtggatcctatggtaaaaactctgtatcacaaaatgta
agtgcgactaacttgctgaacgttaaacgtatcgcggatcggagaaataatatgcaatgg
ttcaaacttccaccaaaaattttctttgaaaaatactccactcaataccttcaaaaaatg
gaaggagttgaacgtgtatttatcgtaactgacccaggaatggttcaattcaaatatgtt
gacgttgtaatcgaacatttgaaaaaacgtggcaacgatgtatcttaccaagtatttgct
gatgttgaaccagatccatctgatgtaacggtttataaaggtgccgaactaatgaaagac
ttcaaacctgatactattatcgcactcggtggtggttcagcaatggatgcagctaaaggt
atgtggttattctatgaacatccagaagcttctttcttcggactaaaacaaaaattctta
gatatccgtaaacgtactttcaaatatcctaaacttggtggaaaagcgaaatttgttgcg
attccaacaacaagtggtactggatctgaagtaactccttttgcggttatcacggataaa
gaaaataacattaaatacccacttgctgactatgaactaactccagacgttgctattgtc
gatgcacaatacgtaacaactgttccagcacacatcactgctgacactggtatggatgtt
ctaactcacgccattgaatcttatgtttctgtaatggcaagtgattatactcgtggttta
tccatccgtgcaatcgaacttgtatttgaaaacctacgtgattccgttcttaagggtgat
cctgatgcacgtgaaaaaatgcataatgcttctgccctagctggtatggcgtttgccaat
gcgttccttggaattaaccatagtttggcacacaaaatcggacctgaattccacatccct
catggtcgtgcgaatgccatccttatgccacacgttattcgttataacgcacttaaacct
aaaaaacatgcgttattcccaagatatgaaagcttccgtgcagatgaagattacgctcgt
atctctcgtattatcggcttccctgctacaactacagaagaaggcgttaaatcacttgta
gatgaaatcatcaaacttggtaaagatgttggtatcgacatgagtcttaaagggcaaaat
gtggcgaaaaaagatttagatgctgttgtagatacacttgcagatcgcgcattcatggac
caatgtactactgccaaccctaaacaaccacttgtaagcgaactaaaagaaatctaccta
gaagcttacaaaggtgtatga

DBGET integrated database retrieval system