KEGG   Listeria ivanovii subsp. ivanovii PAM 55: LIV_1639Help
Entry
LIV_1639          CDS       T01623                                 

Gene name
ansB
Definition
putative asparagine synthetase
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
liv  Listeria ivanovii subsp. ivanovii PAM 55
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:liv00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    LIV_1639 (ansB)
Enzymes [BR:liv01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     LIV_1639 (ansB)
Peptidases [BR:liv01002]
 Cysteine Peptidases
  Family C44
   LIV_1639 (ansB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1723593..1725458)
Genome map
AA seq 621 aa AA seqDB search
MCGFVGCVHDRITEITDADKETFRQMNSMITHRGPDDEGYFTDDHVQFGFRRLSIIDVEN
GHQPLTYENERYWIIFNGEVYNYVELREQLIAEGMTFETESDTEVIIATYAKYKEKTAER
LRGMFGFVIWDKQEELVYGARDPFGIKPFFYAEEDGKLYMGSEKKSLLHALKEKELDEVS
LQNYMTYQFVPEPDSLTKNVKRLEPGHQFTKKIGEPMEITTYWKATFAPVTKSEDAWVKE
VRDVMYDSVKMHMRSDVPVGSFLSGGIDSSIIAAIAKEYHPAIKTFSVGFERDGFSEIDV
AKETADKLGVENISYVISPEEYMKELPKIVWHMDDPLADPAAIPLYFLSREARKQVTVAL
SGEGADELFGGYNIYNEPNSLAVFNKMPKVFKSMLNSVASVMPEGMRGKSFLERGTTPME
ERYIGNAKMFTEKEKQILLPKYQTGHDYTNITDPFYAETKNYHPVERMQYIDIHTWLRGD
ILLKADRMTMANSLEVRVPFLDKEVYNVAKGIPDTMKTTQGTTKYILRKAAATFVPEHVL
NRRKLGFPVPIRHWLKDEMNAWVKNIIKESPTDHLINKKYVLDLLDDHCAGKFDYSRKIW
TVVIFMIWYDVYVADKYDFGK
NT seq 1866 nt NT seq  +upstreamnt  +downstreamnt
atgtgtggatttgtaggatgcgtacatgaccgcattacagagattactgacgctgataaa
gaaacctttagacaaatgaatagtatgattacgcaccgtggacctgacgatgaaggttac
ttcacagatgaccacgtgcaatttggtttccgccgtttaagtattattgatgtagaaaac
ggtcatcaaccgctaacgtatgaaaatgaacgttattggattatttttaatggagaagtt
tataactatgtcgaactccgcgaacaattaatcgctgaaggaatgacatttgaaaccgaa
agtgatacagaagttattatcgctacatatgcgaaatataaagaaaaaacagctgaacgc
ctgcgcggaatgtttggctttgtcatttgggacaaacaagaagaacttgtatacggagca
cgcgacccatttggtatcaaaccatttttctatgcagaagaagacggcaagctttatatg
ggctctgagaaaaaatcccttcttcatgcactaaaagaaaaagaattagatgaagtttcc
ttacaaaattacatgacttaccaatttgttccagaaccagattctttaacaaaaaatgta
aaacgcttggaaccaggtcatcaattcacgaaaaaaattggcgaaccaatggagattacg
acttattggaaagccacttttgcacctgtaacgaaatcagaagacgcatgggtgaaagaa
gtccgagatgtgatgtatgattctgtgaaaatgcatatgcgttcggatgtaccagttgga
tcgtttttatcgggtggaattgattcctcgattatcgcagccattgcgaaagaataccac
ccagctatcaaaacattttcagttggttttgagcgggatggatttagtgaaattgatgtg
gcgaaagaaactgcagacaaacttggtgtagagaacattagttacgtcatttcaccagaa
gaatatatgaaagaattaccaaaaattgtttggcacatggatgatccgcttgctgatccg
gctgctattccgctttacttcttatctagagaagcgcgcaaacaagtaacagttgctttg
tctggtgaaggtgcggatgaactatttggcgggtataatatttataacgaacctaattct
ttagcggtgttcaacaaaatgccaaaagtatttaaatctatgttaaacagtgtggcgagt
gtgatgccagagggaatgcgtggtaaaagtttcttagaacgtggaacaacgccgatggaa
gaacgttacatcggaaatgcaaaaatgttcacagaaaaagaaaaacaaattttacttcca
aaataccaaactggacatgattatacgaatattactgatccgttttatgcggaaacaaaa
aattatcatccagtagaaagaatgcagtacattgatattcatacgtggcttcgcggagat
attcttctaaaagcggaccggatgacaatggccaattccttagaagttcgtgttcctttc
cttgataaagaagtgtacaatgttgcaaaaggaattccggacacaatgaaaacaacgcaa
ggaactacgaaatacattttgcgtaaagcagcagcaacttttgtaccagaacatgtactt
aatcgtcgtaaattaggatttccagtgccaattcgccactggttaaaagacgaaatgaac
gcttgggttaaaaatatcattaaagaatcaccaacagaccatttaattaacaaaaaatat
gtgttagatttactggatgatcactgcgccggaaaattcgactatagtcggaaaatctgg
acagttgtaatctttatgatttggtatgatgtttacgtagcagataaatacgatttcggt
aaataa

DBGET integrated database retrieval system