KEGG   Listeria ivanovii: LIV_1639Help
Entry
LIV_1639          CDS       T01623                                 

Gene name
ansB
Definition
putative asparagine synthetase
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
liv  Listeria ivanovii
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:liv00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1723593..1725458)
Genome map
AA seq 621 aa AA seqDB search
MCGFVGCVHDRITEITDADKETFRQMNSMITHRGPDDEGYFTDDHVQFGFRRLSIIDVEN
GHQPLTYENERYWIIFNGEVYNYVELREQLIAEGMTFETESDTEVIIATYAKYKEKTAER
LRGMFGFVIWDKQEELVYGARDPFGIKPFFYAEEDGKLYMGSEKKSLLHALKEKELDEVS
LQNYMTYQFVPEPDSLTKNVKRLEPGHQFTKKIGEPMEITTYWKATFAPVTKSEDAWVKE
VRDVMYDSVKMHMRSDVPVGSFLSGGIDSSIIAAIAKEYHPAIKTFSVGFERDGFSEIDV
AKETADKLGVENISYVISPEEYMKELPKIVWHMDDPLADPAAIPLYFLSREARKQVTVAL
SGEGADELFGGYNIYNEPNSLAVFNKMPKVFKSMLNSVASVMPEGMRGKSFLERGTTPME
ERYIGNAKMFTEKEKQILLPKYQTGHDYTNITDPFYAETKNYHPVERMQYIDIHTWLRGD
ILLKADRMTMANSLEVRVPFLDKEVYNVAKGIPDTMKTTQGTTKYILRKAAATFVPEHVL
NRRKLGFPVPIRHWLKDEMNAWVKNIIKESPTDHLINKKYVLDLLDDHCAGKFDYSRKIW
TVVIFMIWYDVYVADKYDFGK
NT seq 1866 nt NT seq  +upstreamnt  +downstreamnt
atgtgtggatttgtaggatgcgtacatgaccgcattacagagattactgacgctgataaa
gaaacctttagacaaatgaatagtatgattacgcaccgtggacctgacgatgaaggttac
ttcacagatgaccacgtgcaatttggtttccgccgtttaagtattattgatgtagaaaac
ggtcatcaaccgctaacgtatgaaaatgaacgttattggattatttttaatggagaagtt
tataactatgtcgaactccgcgaacaattaatcgctgaaggaatgacatttgaaaccgaa
agtgatacagaagttattatcgctacatatgcgaaatataaagaaaaaacagctgaacgc
ctgcgcggaatgtttggctttgtcatttgggacaaacaagaagaacttgtatacggagca
cgcgacccatttggtatcaaaccatttttctatgcagaagaagacggcaagctttatatg
ggctctgagaaaaaatcccttcttcatgcactaaaagaaaaagaattagatgaagtttcc
ttacaaaattacatgacttaccaatttgttccagaaccagattctttaacaaaaaatgta
aaacgcttggaaccaggtcatcaattcacgaaaaaaattggcgaaccaatggagattacg
acttattggaaagccacttttgcacctgtaacgaaatcagaagacgcatgggtgaaagaa
gtccgagatgtgatgtatgattctgtgaaaatgcatatgcgttcggatgtaccagttgga
tcgtttttatcgggtggaattgattcctcgattatcgcagccattgcgaaagaataccac
ccagctatcaaaacattttcagttggttttgagcgggatggatttagtgaaattgatgtg
gcgaaagaaactgcagacaaacttggtgtagagaacattagttacgtcatttcaccagaa
gaatatatgaaagaattaccaaaaattgtttggcacatggatgatccgcttgctgatccg
gctgctattccgctttacttcttatctagagaagcgcgcaaacaagtaacagttgctttg
tctggtgaaggtgcggatgaactatttggcgggtataatatttataacgaacctaattct
ttagcggtgttcaacaaaatgccaaaagtatttaaatctatgttaaacagtgtggcgagt
gtgatgccagagggaatgcgtggtaaaagtttcttagaacgtggaacaacgccgatggaa
gaacgttacatcggaaatgcaaaaatgttcacagaaaaagaaaaacaaattttacttcca
aaataccaaactggacatgattatacgaatattactgatccgttttatgcggaaacaaaa
aattatcatccagtagaaagaatgcagtacattgatattcatacgtggcttcgcggagat
attcttctaaaagcggaccggatgacaatggccaattccttagaagttcgtgttcctttc
cttgataaagaagtgtacaatgttgcaaaaggaattccggacacaatgaaaacaacgcaa
ggaactacgaaatacattttgcgtaaagcagcagcaacttttgtaccagaacatgtactt
aatcgtcgtaaattaggatttccagtgccaattcgccactggttaaaagacgaaatgaac
gcttgggttaaaaatatcattaaagaatcaccaacagaccatttaattaacaaaaaatat
gtgttagatttactggatgatcactgcgccggaaaattcgactatagtcggaaaatctgg
acagttgtaatctttatgatttggtatgatgtttacgtagcagataaatacgatttcggt
aaataa

DBGET integrated database retrieval system