KEGG   Listeria ivanovii subsp. ivanovii PAM 55: LIV_1803Help
Entry
LIV_1803          CDS       T01623                                 

Definition
guanylate kinase
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
liv  Listeria ivanovii subsp. ivanovii PAM 55
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:liv00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    LIV_1803
Enzymes [BR:liv01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     LIV_1803
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1910002..1910619)
Genome map
AA seq 205 aa AA seqDB search
MTERGLLIVLSGPSGVGKGTVREAVFKDPETSFDYSISMTTRLPREGEQDGVDYYFRSRE
VFEQAISDGKMLEYAEYVGNYYGTPLEYVEEKLQAGTDIFLEIEVQGAMQVRKAMPEGIF
IFLTPPDLSELKNRIIGRGTESMDVVEERMETAKKEIEMMASYDYAVVNDVVDKAVQKIK
GIVETEHLKTERVIHRYKKMLEGLQ
NT seq 618 nt NT seq  +upstreamnt  +downstreamnt
atgacagaaagaggactattaatcgtactatcaggtccatcaggtgtgggaaaaggaact
gtccgggaagcggtttttaaagacccggaaacaagttttgactactctatctcgatgaca
acacgtcttcctcgtgaaggcgaacaagacggtgttgattattattttcgttcgcgcgaa
gtttttgaacaagctatttctgacggaaaaatgttagaatatgcagagtatgtcggaaat
tattacggcactccgcttgaatatgtcgaggaaaaactacaagcaggtactgatattttt
ctcgaaattgaagtgcaaggagcaatgcaagttcgaaaagcaatgccagaagggattttt
attttcttaactccgccagatttatccgaacttaaaaaccggattatcggccgcggaacg
gaatcaatggatgtggtggaagaacgaatggaaaccgcaaaaaaagaaatcgaaatgatg
gcatcgtatgattatgctgtagtaaacgatgtggtagacaaagctgttcaaaaaatcaaa
ggcatcgtcgaaacagaacacttaaaaaccgagcgagtaattcatcgctacaaaaaaatg
ttggagggattacaatga

DBGET integrated database retrieval system