KEGG   Listeria ivanovii subsp. ivanovii PAM 55: LIV_1814Help
Entry
LIV_1814          CDS       T01623                                 

Gene name
pyrB
Definition
putative aspartate carbamoyltransferase
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
liv  Listeria ivanovii subsp. ivanovii PAM 55
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:liv00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    LIV_1814 (pyrB)
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    LIV_1814 (pyrB)
Enzymes [BR:liv01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     LIV_1814 (pyrB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1922698..1923609)
Genome map
AA seq 303 aa AA seqDB search
MKNLLSMEALTVHEIEHLLEQAAQFKRGKKATLNEQAFAVNMFFEPSTRTLTSFEVAEKK
LGVEVVSFDAASSSMTKGETLYDTLLTMQAVGVNVAVIRHSEENYYEGLEKLDIALVNGG
DGCGEHPSQSLLDLFTIKEQFGTFQGLKVAIAGDIRHSRVANSNMKVLKRLGAELYFSGP
KEWFDESCLEFGTYLSVDEIVEKVDVMMLLRVQHERHSGTEQFTKEGYHSKFGLTIERAA
KLKPDAIIMHPSPVNRDVEIADSLVESEKSRIVTQMTNGVFIRMAILESILKEQEMRAEL
CTY
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaatttgttgtcaatggaagccttaaccgtccatgaaattgagcatttattagag
caggcggcacagtttaaacgaggtaaaaaagcaactttaaatgaacaagcatttgcagtt
aacatgttttttgaaccaagtacgagaacgctcactagttttgaagtagcagagaaaaag
ctaggtgtggaggtagtttcctttgatgcagcaagttctagcatgacaaaaggagaaaca
ttatacgatacgcttcttacaatgcaagcggttggagtaaatgtggcagtcattaggcac
tcggaagaaaattactacgaaggacttgaaaaattagacattgcccttgtgaatggtgga
gatggttgcggggaacatcctagccagtcactactcgatttattcacgataaaagaacag
tttggaacttttcaaggattgaaagtggcgattgctggagatattcgtcatagtagggtc
gcaaattctaatatgaaagtgctaaaacgacttggagcagagctttatttctccgggcca
aaagaatggtttgacgaaagttgcttagagtttgggacttacttatctgtagatgaaatc
gtcgaaaaagtagatgtgatgatgctactccgggtacaacatgagcgccatagtggaacc
gaacaatttacaaaagaaggatatcattcgaaattcggcctaacaatcgaacgagcagca
aaattaaaaccagatgcaattatcatgcacccaagtccagttaaccgcgatgtggaaatt
gcagatagtttagtggaaagcgaaaaatcacgcattgttacgcaaatgacaaatggcgtt
tttataagaatggcgatactagaatcaattttaaaagaacaggaaatgagggcggaacta
tgtacgtattaa

DBGET integrated database retrieval system