KEGG   Listeria ivanovii: LIV_1913Help
Entry
LIV_1913          CDS       T01623                                 

Definition
putative GTP cyclohydrolase I
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
liv  Listeria ivanovii
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:liv00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2020478..2021047)
Genome map
AA seq 189 aa AA seqDB search
MEQIDKQKIADAVKVILEAVGENPEREGLIDTPMRVARMYEEVFAGLKKDPSVHFNTIFE
EQHEELVLVRDIRFFSMCEHHLVPFFGVAHVAYLPQNGRVAGLSKLARVVDDVSKRPQLQ
ERITTTVAEIMMDKLKPLGVMVIMEAEHMCMTIRGVNKPGTKTITSAVRGAFKNDDKLRS
EVLALIKHN
NT seq 570 nt NT seq  +upstreamnt  +downstreamnt
atggagcaaatagacaaacaaaaaattgcggatgcagtcaaagtcattttagaagcagtg
ggggaaaatccagaacgtgaaggtctaattgatactccaatgcgagttgctcggatgtat
gaagaagtttttgccggattgaaaaaagacccttctgttcatttcaacactatttttgaa
gaacaacatgaagaattagtgcttgtaagagatattcgttttttctctatgtgtgaacat
catcttgttcctttcttcggcgtagcgcatgtggcttatttgccgcaaaatggccgggtt
gccggacttagtaaacttgcaagggtagtggatgatgtaagtaagcgcccacaacttcaa
gaacgtattacaactaccgtagcagaaattatgatggacaaattaaaaccattaggggtt
atggttatcatggaagcagaacatatgtgcatgactattcgtggcgtaaataaaccagga
actaaaacaattacaagtgcagtacgaggcgcttttaaaaatgatgataaactgagaagt
gaagttttggctttaatcaagcataattaa

DBGET integrated database retrieval system