KEGG   Listeria ivanovii: LIV_2081Help
Entry
LIV_2081          CDS       T01623                                 

Definition
putative L-fuculose-phosphate aldolase
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
liv  Listeria ivanovii
Pathway
Fructose and mannose metabolism
Class
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:liv00051]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2196032..2196682)
Genome map
AA seq 216 aa AA seqDB search
MLYQKEREDLAKIVKTMFDRFETNAAGGNVSVRMNREHIIMTPTLMSQAKLCDLSPYEIL
VVDNNNEVVEGDGKITREINLHRACYVENPDIGCVLHAHPKESMLFATLGMELPNLTEAT
QKIGRIPTLTFAPATSPELAEIVRKHVIELADKAVPSASLLNKHGIVVLESTLHKAYDML
ERIEYNAYIAEKAMVFDALNIKKLVHDGELNYNLEE
NT seq 651 nt NT seq  +upstreamnt  +downstreamnt
atgttataccaaaaagaacgtgaagatttagcgaaaatagtgaagaccatgtttgaccgc
tttgaaacgaatgcagcgggtggaaatgttagtgttagaatgaaccgagagcacattata
atgacgccaacactaatgagccaagcaaaattgtgtgacctttctccctacgaaattctt
gttgtagacaataataatgaagtagtagagggcgacgggaaaattacgcgggaaattaat
ttacatcgtgcttgttatgtagaaaatcccgatattggttgtgttcttcatgcgcatccc
aaagagtccatgttatttgcaacactaggtatggaactcccgaatttaacagaagcaact
caaaaaataggacggattccaacacttacttttgcccctgcaactagcccagaattggca
gaaatcgttcgaaaacatgtcattgaattagcagataaggcagtgccaagtgcgagctta
cttaataaacacggtattgttgtattagagtccacattgcataaagcctacgatatgtta
gaacggattgaatataatgcgtatattgctgaaaaagcgatggtgtttgatgcattaaat
ataaaaaaattagtacatgacggagaattaaattataatttggaggagtaa

DBGET integrated database retrieval system