KEGG   Listeria ivanovii subsp. ivanovii PAM 55: LIV_2355Help
Entry
LIV_2355          CDS       T01623                                 

Definition
putative carboxylesterase
Orthology
K03928  
carboxylesterase [EC:3.1.1.1]
Organism
liv  Listeria ivanovii subsp. ivanovii PAM 55
Brite
Enzymes [BR:liv01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.1  carboxylesterase
     LIV_2355
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2498616..2499362)
Genome map
AA seq 248 aa AA seqDB search
MKITPPQPFLFEKGPRAVLLLHGFTGSSADVRILGRFLQENNYTCYAPQYRGHGVSPDLL
LQTGPKEWWEDVLAAYDHLKSLGYKEIAVAGLSLGALFSLKLGFSKPLKGIIAMSTPTRM
DSSSPIIQGFLDYVRNYKKLEGKTPEQIDSEMLAYKDAPMNTIAKLKDEINGVAAEMDMI
YAPIMVVQGEKDDMVDVSGAQLIYDTVESTEKELHWFKNSGHVITLDKERKEVNQAILTF
LDSLDWQE
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atgaaaataacaccaccacaaccatttttattcgaaaaaggtcctcgagcagtattgctt
ttacacggatttacaggaagctcagcggatgttagaattctaggtaggtttttacaagaa
aataattacacatgttatgcacctcaatacagaggtcacggtgtgtcaccagatttatta
ttacaaacaggcccgaaagaatggtgggaagatgttcttgcagcatatgaccacttaaag
tcgcttggttataaagaaatagctgtggctggactttcactaggggcacttttttcatta
aaattaggtttttctaagccattaaagggaattatagccatgagcactcctacaagaatg
gacagctcatcgccaatcattcaaggctttttggattatgttcgtaattataaaaaatta
gaaggtaaaacaccagaacaaattgatagtgaaatgttggcatacaaagacgcgccaatg
aataccattgcaaaactaaaagatgaaataaatggtgtggctgctgaaatggatatgatt
tatgccccaattatggttgttcaaggggaaaaagatgatatggtcgatgtaagcggagca
cagttaatttatgatacagtagagtcaacagaaaaagaattacattggttcaaaaattct
ggtcatgtaataacactagataaagaacgaaaagaagtaaatcaagctattttaaccttt
ttagatagtctagactggcaagaataa

DBGET integrated database retrieval system