KEGG   Listeria ivanovii subsp. ivanovii PAM 55: LIV_2362Help
Entry
LIV_2362          CDS       T01623                                 

Gene name
tpi
Definition
(RefSeq) putative triose phosphate isomerase
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
liv  Listeria ivanovii subsp. ivanovii PAM 55
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:liv00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    LIV_2362 (tpi)
   01230 Biosynthesis of amino acids
    LIV_2362 (tpi)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LIV_2362 (tpi)
   00051 Fructose and mannose metabolism
    LIV_2362 (tpi)
   00562 Inositol phosphate metabolism
    LIV_2362 (tpi)
Enzymes [BR:liv01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     LIV_2362 (tpi)
Exosome [BR:liv04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   LIV_2362 (tpi)
  Exosomal proteins of bladder cancer cells
   LIV_2362 (tpi)
  Exosomal proteins of melanoma cells
   LIV_2362 (tpi)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2504957..2505712)
Genome map
AA seq 251 aa AA seqDB search
MRKPIIAGNWKMNKTAAKAGQFAEDVKNNVPSSDAVESVVAAPALFLQELVRLTEGTNLR
VSAQNCYFEDEGAFTGEISPFALADLGVSYVIIGHSERREYFHETDEDINKKAHAIFKHG
MTPIICCGETLDQREAGQTDTWVRGQIRAALAGLTEEQVIKSVIAYEPIWAIGTGKSSTS
ADANETCAVIRAEVADAVSQKAADAVRIQYGGSVKPENIADYLAESDIDGALVGGASLEP
ESFLALLEAVK
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atgcgtaaaccaattattgctggtaactggaaaatgaacaaaacggctgcaaaagctgga
caatttgcagaagacgtaaaaaataatgtaccttcaagcgatgctgttgaatcagtagtt
gctgcaccggctttatttttacaagaattagttcgtcttactgaaggaactaatctacgt
gtttctgcacaaaactgttatttcgaggacgaaggtgctttcacaggcgaaattagcccg
tttgcacttgctgatttaggtgtttcttatgtgattatcggacactctgaacgacgtgag
tatttccacgaaacagacgaagatatcaacaaaaaagcacacgcaatcttcaaacatggc
atgacaccaatcatttgttgtggtgaaacacttgatcaacgtgaagctggtcaaactgat
acttgggttcgcggtcaaatccgtgcagcacttgctggattaacggaagaacaagtaatc
aaatctgttattgcttatgaaccaatctgggcaatcggtactggaaaatcttccacaagt
gctgatgcaaacgaaacttgtgcagttattcgtgccgaagttgcagatgctgtatctcaa
aaagcagcagacgcagttcgtattcaatacggcggtagcgtaaaacctgaaaacattgct
gattatcttgcagagtccgatattgacggagctcttgtaggtggagcaagcttagaacca
gaatcgttcttagcattattggaggcagtaaaataa

DBGET integrated database retrieval system