KEGG   Listeria ivanovii subsp. ivanovii PAM 55: LIV_2436Help
Entry
LIV_2436          CDS       T01623                                 

Gene name
murA
Definition
putative UDP-N-acetylglucosamine 1-carboxyvinyltransferase
Orthology
K00790  
UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
liv  Listeria ivanovii subsp. ivanovii PAM 55
Pathway
Amino sugar and nucleotide sugar metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:liv00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    LIV_2436 (murA)
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    LIV_2436 (murA)
Enzymes [BR:liv01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.7  UDP-N-acetylglucosamine 1-carboxyvinyltransferase
     LIV_2436 (murA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2582458..2583750)
Genome map
AA seq 430 aa AA seqDB search
MEKIIVRGGKQLNGSVKMEGAKNAVLPVIAATLLASKGTSVLKNVPNLSDVFTINEVLKY
LNADVSFVNDEVTVDATGDITSDAPFEYVRKMRASIVVMGPLLARTGSARVALPGGCAIG
SRPVDLHLKGFEAMGAIVKIENGYIEATAEKLVGAKVYLDFPSVGATQNIMMAATLAEGT
TIIENVAREPEIVDLANFLNQMGARVIGAGTEVIRIEGVKELTATEHSIIPDRIEAGTFM
IAAAITGGNVLIEDAVPEHISSLIAKLEEMGVQIIEEDNGIRVIGPDKLKAVDVKTMPHP
GFPTDMQSQMMVIQMLSEGTSIMTETVFENRFMHVEEMRRMNADMKIEGHSVIISGPAKL
QGAEVAATDLRAAAALILAGLVADGYTQVTELKYLDRGYNNFHGKLQSLGADVERVDDSK
VDMKNLASLF
NT seq 1293 nt NT seq  +upstreamnt  +downstreamnt
ttggaaaaaattattgtacgcggtggaaaacagttaaatggatctgtaaaaatggaaggc
gccaaaaatgctgtattaccggtgattgctgctacattacttgcgagtaaaggtactagc
gtattgaaaaacgtcccaaatttgtctgatgtattcacaattaatgaggtacttaaatac
ctaaatgcagatgtttcttttgtaaatgatgaggttactgttgatgcaaccggagatatt
acatcggatgcaccttttgagtatgtgcgtaaaatgcgtgcttctattgttgtaatgggt
ccacttttagctcgtactggttctgctcgtgtagctttgccagggggatgtgctattggt
tcaagaccagttgacttacatttaaaaggttttgaagccatgggagcaattgtaaaaatt
gaaaacgggtatattgaagcaacagcagaaaaattagttggagctaaggtttacttagat
tttccaagtgtaggtgcaactcaaaatattatgatggctgctactttagcagagggtaca
acgataattgaaaacgttgctcgtgaaccagaaattgttgacttggcgaacttccttaat
caaatgggagctagagttattggtgcaggaacagaagtaattagaattgaaggcgtaaaa
gaactaacagctacagaacattccattattccagaccgtattgaagcaggtacatttatg
attgctgctgcgattactggtggaaatgttttaattgaagatgcagttcccgagcatatt
agttcactgattgctaaattagaagaaatgggcgttcaaattattgaagaagataacggt
attcgtgttattggaccagataagttgaaagctgttgatgttaaaacaatgccgcaccca
ggttttccaactgatatgcaatctcaaatgatggttattcaaatgttaagtgaaggtaca
agtattatgaccgaaactgtttttgaaaaccgttttatgcatgttgaagaaatgcgtaga
atgaatgctgacatgaaaattgaaggacattctgttattatctctggtccagcaaaatta
caaggagcagaagttgcagcaaccgatttacgtgcagcagcagcgcttattcttgcaggc
cttgtggctgatggatatactcaagttacagagttgaaatatttggatagaggctacaat
aatttccatggcaaactgcaatctcttggtgcagatgtggaacgtgtagacgattctaaa
gttgatatgaaaaacttagcttcattattttaa

DBGET integrated database retrieval system