KEGG   Listeria ivanovii subsp. ivanovii PAM 55: LIV_2484Help
Entry
LIV_2484          CDS       T01623                                 

Definition
putative nicotinamidase
Orthology
K08281  
nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-]
Organism
liv  Listeria ivanovii subsp. ivanovii PAM 55
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:liv00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    LIV_2484
Enzymes [BR:liv01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.19  nicotinamidase
     LIV_2484
    3.5.1.-  
     LIV_2484
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2628086..2628718)
Genome map
AA seq 210 aa AA seqDB search
MKIAAFDIDAQKGFSPLCPDELPVPGGDEIVPELNFMASLASLRIGSKDAHPQNAVWVVD
SKDEMLATLEYPNADLTWVRHCEPGTKGFELLDGLPQVTDYNYFIWKGMERDIHPYGACY
HDILEQLSTGVLEYLREEKVDLVLVGGLAFDFCVKTTVIQLSRAGFSVVVYLPATRALSE
QGFDETRAQLANTDKVQLIETREELVAYCG
NT seq 633 nt NT seq  +upstreamnt  +downstreamnt
atgaaaattgcagcttttgatattgatgcacagaaaggtttctcaccgctttgcccagat
gagctacctgtgccaggcggggatgaaattgttccagaactgaactttatggcaagcctt
gcatcgcttcgtataggtagtaaagacgcgcatccacaaaatgcagtatgggtggttgac
tcaaaagatgaaatgctagcgacactagaatatccaaatgcagatctcacttgggtaagg
cactgtgaacctggaacaaaaggttttgaactattagacgggttaccacaagtgacggat
tataattatttcatttggaaaggaatggaacgagatattcatccatacggggcgtgttat
cacgatatccttgaacagctttcaacaggtgttttagagtatttacgagaagaaaaagtc
gatttagttcttgttggaggtttagcatttgacttttgcgtgaaaactacggttatacag
ttaagtagggcaggcttttctgtagtagtatatttacccgcgacacgtgcgttatctgaa
caaggttttgatgaaacgagagcacaactagcaaacaccgataaagttcaacttatcgaa
acaagggaggaacttgtcgcctactgcgggtaa

DBGET integrated database retrieval system