KEGG   Listeria ivanovii subsp. ivanovii PAM 55: LIV_2656Help
Entry
LIV_2656          CDS       T01623                                 

Gene name
recR
Definition
putative recombination protein recR
Orthology
K06187  
recombination protein RecR
Organism
liv  Listeria ivanovii subsp. ivanovii PAM 55
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:liv00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    LIV_2656 (recR)
DNA repair and recombination proteins [BR:liv03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      LIV_2656 (recR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2795192..2795788)
Genome map
AA seq 198 aa AA seqDB search
MHYPEPITKLMDSFMKLPGIGPKSAARLAFYVLDMKEDDVLDFAKALVDAKRNLSFCSVC
GHITDKDPCYICADTSRDRSIICVVQESKDVIAMEKMRDFHGLYHVLHGTISPMDGIGPE
DINIPDLLKRLQDDTIEEVILATNPNVEGEATAMYISRLLKPSGIKITRIAHGLPVGGDL
EYADEVTLSKAMEGRREV
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
atgcattatcctgagccgataacgaaattaatggacagttttatgaaattaccgggtatc
ggacccaaatcggcagcaagactcgcattttatgtgcttgatatgaaagaagacgatgta
ttagattttgcaaaagcgctagttgatgcaaaacgaaatttgagcttttgttctgtttgt
ggacatattacagataaagatccttgctacatttgtgcggatacatctcgtgaccgcagt
atcatttgtgtagtgcaagaatcaaaagatgttattgctatggaaaaaatgcgcgatttt
catggtttatatcacgtgcttcatggaacaatttcaccaatggatgggattggaccagaa
gatattaatattcctgatttacttaaacgtttgcaagatgacacgattgaggaagttatt
ttagcgactaaccctaatgtagaaggagaagctacggcgatgtatatttcgcgtctatta
aaaccatctggtataaagataactagaatagcgcacggtcttccagttggtggagatttg
gaatacgctgatgaagtgacgctttcaaaagcaatggaaggacgaagagaagtataa

DBGET integrated database retrieval system