KEGG   Listeria ivanovii subsp. ivanovii PAM 55: LIV_2675Help
Entry
LIV_2675          CDS       T01623                                 

Definition
putative acetate-CoA ligase
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
liv  Listeria ivanovii subsp. ivanovii PAM 55
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:liv00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    LIV_2675
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LIV_2675
   00620 Pyruvate metabolism
    LIV_2675
   00640 Propanoate metabolism
    LIV_2675
  Energy metabolism
   00680 Methane metabolism
    LIV_2675
Enzymes [BR:liv01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     LIV_2675
Lipid biosynthesis proteins [BR:liv01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   LIV_2675
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2813886..2815463
Genome map
AA seq 525 aa AA seqDB search
MNSENLLAPELYNITDEIAKFSSEKTALIWRNEHDETKTWSYRHLLEQANKFANVAKDAG
VKKGDHVIVMTPRLLETYAIYMGLWKAGAIIIPASELLKAHDLEYRIHHANVKAIVSYNG
MTAEFDKINDIPSVAKKIIVGEKLAGWDHYETLMEQASVEFERVETSRDDACLLAFTSGT
TGNPKGVVHIHGWGYAHIRIAADHWLDIHEDDIVWATAGPGWQKWVWSPFLSVLGKGATG
FIYNGRFIPEKQLNLLSEEKINVLCCTPTEYRLMAKVNNLREHDLSSLRSAVSAGEPLNR
EVIQVFQDNFDIKVRDGYGQTESTLLIGTLVDTPIRPGSMGKPIMPEYMAIIDADGNPVG
VGEIGDIAMRRDFPALFKEYYKEPERLQKAIRGDYFVSGDRAIRDEDNYYWFQGRNDDII
ISSGYTIGPFEVEDALTHHPAVKEVAVVASPDEIRGTVVKAFIVLKDGYEGTDDLVHELQ
TFTKEQTAPYKYPRRIEFASALPKTDSGKIRRVELRDAEFASVHK
NT seq 1578 nt NT seq  +upstreamnt  +downstreamnt
atgaattcagagaacctacttgctccagaactttataatattaccgacgagattgctaaa
tttagttctgaaaaaacagctttaatttggagaaatgaacacgatgaaacaaaaacttgg
agttaccgccacctgcttgaacaagcgaataagtttgcgaatgttgcgaaagatgccggc
gtaaaaaaaggcgatcatgttatcgtaatgactcctcgcttgctcgaaacatatgcgatt
tatatgggcctatggaaagctggagccatcattattcccgcttccgaattacttaaagca
cacgatttagaataccgcatccatcatgctaatgtgaaagcaattgtttcttataacgga
atgactgctgaatttgataaaattaacgacatcccatctgttgccaaaaagattattgtt
ggcgaaaaattagctggttgggatcattatgaaacattaatggaacaggcttcagtagaa
ttcgaacgggtggaaacttcccgcgatgatgcatgcttacttgctttcactagtggaaca
acaggtaatcctaaaggcgttgtacatattcatggttggggttacgcgcatattcgtatc
gcagccgatcactggctagacattcatgaagacgatattgtctgggcaactgcaggaccc
ggctggcaaaaatgggtctggtctccattcctatccgttcttggaaaaggcgcgactggt
ttcatttataatggccgcttcattcctgaaaaacaactcaacctgcttagcgaagaaaaa
atcaacgtcctatgctgtacgccaacagaatatcgcttaatggcaaaagtaaataatttg
cgcgaacatgatttaagttcccttcgcagtgctgtttcagcaggtgagccactaaaccgt
gaagtaattcaagttttccaagacaattttgacattaaagttcgtgatggttatggacaa
acagaaagcacattattgattggaacgcttgtagatacgccaattcgccccggttcaatg
ggcaaaccaattatgcctgagtatatggcgattattgatgctgatggaaatccggttggt
gttggtgaaatcggtgatattgcaatgcgtagagatttcccagcattgtttaaagaatac
tataaagaacctgaacgccttcaaaaagcgattcgcggtgactattttgtttctggcgac
cgtgcaattcgtgatgaggataattactactggttccaaggtcgaaatgacgatattatt
attagctctggttacacgattggaccttttgaagtggaagacgccttgactcatcaccct
gctgtgaaagaagtagctgttgtcgcaagccctgatgaaatccgcggcaccgtcgtaaaa
gctttcatcgtcttaaaagatggttacgagggcacagacgaccttgttcacgagctgcaa
acatttactaaggaacaaactgctccatataaatatccgcgccgtatcgagtttgcaagc
gctctgccaaaaactgattctgggaaaattcgtcgtgtggaattacgtgatgctgaattt
gcaagtgtgcataaataa

DBGET integrated database retrieval system