KEGG   Listeria ivanovii subsp. ivanovii PAM 55: LIV_2736Help
Entry
LIV_2736          CDS       T01623                                 

Definition
putative ribokinase
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
liv  Listeria ivanovii subsp. ivanovii PAM 55
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:liv00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    LIV_2736
Enzymes [BR:liv01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     LIV_2736
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2875747..2876607)
Genome map
AA seq 286 aa AA seqDB search
MSRIVVLGSCSIDYVVETDRQPQTGETIEGIEFKKYFGGKGANQAVAAKRFGGDVAFVGA
VGKDDAGTQILTNFKKEGIQTNFVQQVDGATGAAVITIMNGDNSIIYVPGANHQFDIADF
SKVFEGAKIVLLQLELPTEIIIQALTYCEENGITTILDPAPSDLFSAEMFEKANYITPNE
MEFTEIAKKLHTTEKELLMENPQKIIISKGAQGVSYVDNGKQINIPAEKVEAVDSTGAGD
TFTGVFAAMLAEESFEQAVKWAVKASAISVKSKGAQKGMPTRMVLK
NT seq 861 nt NT seq  +upstreamnt  +downstreamnt
atgagtagaatagttgttcttgggagctgctccattgactatgtcgtggagactgatcgc
cagccacaaacgggcgaaacaatcgaaggcatagaattcaaaaaatattttggtggtaag
ggcgcaaaccaagcagttgcagctaaacgttttggtggagatgttgcttttgtaggagct
gtggggaaagacgatgcaggtacgcagattttaactaattttaaaaaagaaggtattcaa
accaactttgtacaacaggtagatggagcgactggggcagctgtcataactattatgaat
ggcgataattcgattatttacgttccaggcgccaaccatcagtttgatatagctgacttt
tctaaagtttttgaaggagctaagattgtcttacttcaattggaattgccaacagaaatc
atcatacaggcactaacttattgtgaagagaacggaattactacgattttagaccctgcg
ccatccgatttgttttctgcggaaatgtttgaaaaagcaaattatatcacaccaaatgaa
atggaattcacggagattgctaaaaaactgcatactacggaaaaagaactgctgatggaa
aatcctcagaaaatcattatttcaaaaggtgcacaaggtgtaagctatgtcgataatggg
aagcaaataaatattccagctgaaaaagtggaggcagtggactcgacgggagctggagat
acattcacaggtgtttttgcggcaatgttagcagaagaaagttttgaacaagccgtaaag
tgggcagtaaaagcaagtgcaatttctgtcaaatcaaaaggcgctcagaaaggaatgcca
actagaatggtgctaaaatga

DBGET integrated database retrieval system