KEGG   Listeria ivanovii: LIV_2773Help
Entry
LIV_2773          CDS       T01623                                 

Definition
putative sucrose phosphorylase
Orthology
K00690  
sucrose phosphorylase [EC:2.4.1.7]
Organism
liv  Listeria ivanovii
Pathway
Starch and sucrose metabolism
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:liv00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2913741..2915447)
Genome map
AA seq 568 aa AA seqDB search
MTNLRKRLSRLYPEDVVNSLAARIEARVNETKQQKLTRKSKWDEKDIVLITYGDGDQFQE
EAEKRLTSFKKMYDGYLKSVFELVHFLPFYPYSSDDGFSVIDYKQVNPELGDWSDIHEME
KSARLMFDFVCNHMSAKSDWFQRYLAGDPEFANFFVEMARNTDLSSVTRPRATPVLTPFK
FTSGEEKYIWTTFSDDQIDLNFANPEVLYRMVDVLLFYLEQGAEYVRLDAVGFMWKVPGT
SSIHLEETHEIVKLFRDLVDMSAPGTIIVTETNVPHVDNISYFGNGEKEAHMVYQFPLPP
LVLHAIHHGNAAFLSDWARNLELPEGKRTFFNFLASHDGIGLNPVRGIIPEAEILALVNE
LEREGALVSYKKNPDGSKSPYEINVTYMDALSKQTDSDLARLHRFVVAHAVLLSIPGVPA
VYIQSILGSRNDVAGVAKTGQNRSINRKKYNLTEITAEIEDKGSLRNATYEALTKLINVR
KSESLFHPEIQMEVIDSPAELFVIKRFSGAESLILIHNLSEKEVDYSIDSGIYTNIYTNS
TITGSDSITLSGYEFCWLKTKNYREEQK
NT seq 1707 nt NT seq  +upstreamnt  +downstreamnt
atgacaaatttaagaaaacgactttcgcgattatatccggaagatgtggtaaacagttta
gcagcaagaatcgaagcgcgagtaaatgaaacgaaacagcaaaaattaacacgtaagagt
aagtgggatgagaaagatattgttttaattacatatggggacggggaccagtttcaagaa
gaagcagaaaaaaggttaacaagttttaagaaaatgtacgatggttatttaaaatcagtt
tttgaattagttcattttttaccgttttatccgtattcgtcggatgatggattttctgtg
attgattataagcaggtaaatccggaacttggtgactggtcggatattcatgaaatggaa
aaatcggcacggttgatgtttgattttgtttgtaatcatatgtcagcaaaaagtgattgg
tttcagcgatatttggcgggagatccagaatttgcaaatttctttgtggaaatggctcgg
aatacagaccttagttcagtaactaggccacgtgcgactcctgtgcttacaccatttaag
tttacttcaggagaagaaaagtatatttggacgacttttagtgatgatcaaattgattta
aatttcgcgaatccggaagtgctttataggatggtggatgtcctgctattttatttggaa
caaggggcggaatatgtacgactcgatgcagtgggctttatgtggaaagtgcctggaact
agctcgattcatttagaggaaacacatgaaattgtaaaattatttagagatttagtggat
atgtcggctccaggaacgattattgttacggaaaccaatgtgccgcatgtggataatatt
agctactttggaaacggtgaaaaagaagcacatatggtataccaattcccgcttccaccg
ctcgtattacacgcaattcatcatggtaatgcagcttttctaagtgattgggcgcggaat
cttgagttgccagagggtaagcgaactttctttaacttccttgcttctcatgatggtatc
ggtttaaatccagttcgtggaattatcccagaagcagagattttggcattagtgaatgag
cttgagcgagaaggagctcttgtttcctataagaaaaacccagatggttctaaaagtcct
tatgaaattaatgtgacttatatggatgcgcttagtaaacaaacggatagcgatttagct
agattacaccgctttgtagtagctcatgcagtactgctgtcgattcctggtgttccagct
gtatatattcaaagcattttagggagtagaaatgatgttgccggtgttgcaaaaactggt
caaaatcgctctattaaccgaaaaaaatataatttaacagaaattacagctgaaatagaa
gataaagggtcactacgaaatgcaacttatgaagcgttaacaaaactgattaacgtacga
aaatcggaatcacttttccatccagaaatacagatggaagttatcgattctccggcggaa
ttatttgttatcaaacgattttccggcgcagaatcacttatattgattcataatttatca
gaaaaagaagtagattactcaatagacagcggcatttatacaaatatttatacgaactcc
actataactgggagcgattccataacacttagtggctatgaattctgctggctaaaaacc
aaaaattacagggaggaacaaaaatga

DBGET integrated database retrieval system