KEGG   Listeria ivanovii WSLC3009: AX25_07360Help
Entry
AX25_07360        CDS       T03045                                 

Definition
(GenBank) 3-ketoacyl-CoA thiolase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
liw  Listeria ivanovii WSLC3009
Pathway
liw00071  Fatty acid degradation
liw00072  Synthesis and degradation of ketone bodies
liw00280  Valine, leucine and isoleucine degradation
liw00310  Lysine degradation
liw00362  Benzoate degradation
liw00380  Tryptophan metabolism
liw00620  Pyruvate metabolism
liw00630  Glyoxylate and dicarboxylate metabolism
liw00640  Propanoate metabolism
liw00650  Butanoate metabolism
liw00900  Terpenoid backbone biosynthesis
liw01100  Metabolic pathways
liw01110  Biosynthesis of secondary metabolites
liw01120  Microbial metabolism in diverse environments
liw01130  Biosynthesis of antibiotics
liw01200  Carbon metabolism
liw01212  Fatty acid metabolism
liw02020  Two-component system
Brite
KEGG Orthology (KO) [BR:liw00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    AX25_07360
   00630 Glyoxylate and dicarboxylate metabolism
    AX25_07360
   00640 Propanoate metabolism
    AX25_07360
   00650 Butanoate metabolism
    AX25_07360
  Lipid metabolism
   00071 Fatty acid degradation
    AX25_07360
   00072 Synthesis and degradation of ketone bodies
    AX25_07360
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    AX25_07360
   00310 Lysine degradation
    AX25_07360
   00380 Tryptophan metabolism
    AX25_07360
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    AX25_07360
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    AX25_07360
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    AX25_07360
Enzymes [BR:liw01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     AX25_07360
Exosome [BR:liw04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   AX25_07360
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III
Motif
Other DBs
NCBI-ProteinID: AHI55915
Position
complement(1480870..1482039)
Genome map
AA seq 389 aa AA seqDB search
MNEVVIIDAARTPIGKFGGSLKDISAVELGTTVVKGLLERANISPEEVDQVIFGNVLQSG
LGQNVARQIAINAGIPYQVPGVTINEVCGSGLKSIMFGKQAIQLGEAEIVVVGGTENMSQ
APLLLNPELVEEEVNPKNLKNSMLIDGLTDVFGEYHMGITAENVAKKFAVSREEQDAFAH
NSQMKAAKAQEKNLFEDEIIPVQLADGSFFNKDETIRANSTLEKLATLKSAFKEDGTVTA
GNASGINDGASAIILMSKEKAIAEKIPYLATIKITSEVGVDPAIMGYAPYYAVNEALTKG
GYSIDEIDLFHLNEAFASQSVAVARDLKIPENKLNIYGGAIALGHPIGASGARIVVSLLN
ELKHENKRTGLASLCIGGGIGIAMVVERA
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
atgaacgaagtagttataatagatgccgctcgcacaccaattggaaaatttggtggaagt
ttgaaagacataagtgcagtagaattaggaacaactgttgtaaaaggacttttagaaaga
gctaatatttcgcctgaagaagtagatcaagttatttttggtaatgtgttacaatctggt
cttggccagaatgtagctcgacaaatcgctattaatgcaggaattccttatcaagttcct
ggtgtaactattaatgaagtttgtggatctggtttaaagtccattatgtttggtaaacaa
gcaatccaactaggagaagcagaaattgttgtagtcggagggactgaaaacatgtcccaa
gcaccattactgcttaatcctgaattagtagaggaagaagtcaatcctaaaaatctgaaa
aatagtatgttaatcgatggtttaactgatgtgtttggtgaataccatatggggattacc
gctgaaaacgttgcaaaaaagtttgctgtgtctcgtgaagaacaagatgccttcgcacat
aactcgcagatgaaagcagcgaaagcccaagaaaaaaatctttttgaggatgaaattatt
ccagtacaattagcagatgggtcttttttcaacaaagatgaaaccattcgtgctaattcg
actttagaaaaacttgctacactgaaaagcgcttttaaagaagacggaacagtgacagca
gggaacgcatccggtattaacgacggtgcttctgccattattttaatgtctaaagaaaaa
gccatagcagaaaaaattccttatttagcaaccatcaagatcacatcagaagttggtgtt
gatcctgctattatgggatatgcgccttattatgcagtaaatgaagctttaacaaaaggc
ggctacagcatagacgaaatagacttattccaccttaatgaggcttttgcttctcaatca
gttgctgttgcaagagatttaaaaattccagaaaacaaattaaatatttatggcggcgct
attgcgttaggacacccaatcggtgcatctggagctcgcattgtcgtatcattattaaat
gagttaaaacacgaaaacaagcgcactggtctagcctcgttatgtattggtggcgggata
ggtattgcaatggttgttgaaagagcatag

DBGET integrated database retrieval system