KEGG   Lotus japonicus: Lj0g3v0314989.1Help
Entry
Lj0g3v0314989.1   CDS       T04348                                 

Gene name
Lj0g3v0314989.1
Definition
(Kazusa) -
  KO
K01193  
beta-fructofuranosidase [EC:3.2.1.26]
Organism
lja  Lotus japonicus
Pathway
Galactose metabolism
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lja00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    Lj0g3v0314989.1 (Lj0g3v0314989.1)
   00500 Starch and sucrose metabolism
    Lj0g3v0314989.1 (Lj0g3v0314989.1)
Enzymes [BR:lja01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     Lj0g3v0314989.1 (Lj0g3v0314989.1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
AA seq 193 aa AA seqDB search
MAYLYRSRDFFKWVRAKHPIHSAKTGMWECPDFYPVSLKGKEGLDTSMVGTNVKHVLKNS
LDMTRFEYYTLGTYFMNKDKYIPDNTSEDGWGGLRYDYGNFYASKSFFDPSKNRRILWGW
ANESDSKDDDIKKGWAGIQAIPRSVWLDSTGRQLVQWPVEELNSLREREVNMNNHKLEKG
DHIEVDGITAAQV
NT seq 579 nt NT seq  +upstreamnt  +downstreamnt
atggcctatttgtataggagcagagattttttcaagtgggttcgagctaaacacccgatc
cattcagcgaaaacaggtatgtgggagtgcccggatttttacccggtttctttgaaaggg
aaagaaggattggacacttcaatggtggggactaatgttaaacatgtgttgaagaatagt
cttgacatgactaggttcgagtactacacgttgggaacttattttatgaataaggataag
tatattcctgataatacttcagaggatggttggggtggccttagatatgactatggtaat
ttctatgcttctaagtcattttttgaccctagcaaaaaccgtaggatcttgtggggttgg
gcgaacgaatctgattccaaggatgatgatattaaaaagggttgggcaggaattcaggca
attccaagatcggtgtggcttgattctactggtagacaattggttcaatggcccgttgaa
gagttgaatagtcttagagagagagaagttaatatgaacaatcacaagcttgaaaaggga
gatcatattgaagtagatggaataactgcagcccaggtc

DBGET integrated database retrieval system