KEGG   Lactobacillus jensenii: BUE77_02950Help
Entry
BUE77_02950       CDS       T04677                                 

Definition
(GenBank) 3-ketoacyl-CoA thiolase
  KO
K00626  
acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
lje  Lactobacillus jensenii
Pathway
Fatty acid degradation
Synthesis and degradation of ketone bodies
Valine, leucine and isoleucine degradation
Lysine degradation
Benzoate degradation
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Propanoate metabolism
Butanoate metabolism
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Fatty acid metabolism
Two-component system
Brite
KEGG Orthology (KO) [BR:lje00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    BUE77_02950
   00630 Glyoxylate and dicarboxylate metabolism
    BUE77_02950
   00640 Propanoate metabolism
    BUE77_02950
   00650 Butanoate metabolism
    BUE77_02950
  Lipid metabolism
   00071 Fatty acid degradation
    BUE77_02950
   00072 Synthesis and degradation of ketone bodies
    BUE77_02950
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BUE77_02950
   00310 Lysine degradation
    BUE77_02950
   00380 Tryptophan metabolism
    BUE77_02950
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    BUE77_02950
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BUE77_02950
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    BUE77_02950
Enzymes [BR:lje01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     BUE77_02950
Exosome [BR:lje04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BUE77_02950
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
595070..596215
Genome map
AA seq 381 aa AA seqDB search
MQDIYIIAAKRTPFGRYRGQLAAFNAVELGTYALKDALKAANLRSSDLDALFMGNVLSAG
LGQNMARQVAINSGMREESVATTINEVCGSSLKAVRLAQAQMLIGDLDLVAVGGSESMTN
APLLAKKSEKDNPNFVDSMLNDGLTDSFSNKLMGNTCENVAVKYGISRAEADEFSVNSHQ
KAARAQAAGFFNQEITPLAELDHDENVRPDSNVEKLASLKTVFKEGGVATAGNSSPLSDG
ASMLILATEDKVKELNLKPLAKLTAYAEVGLDPQIMGFGPKVVIEKLLQENGQTLADIDL
FEINEAFAATSLAVEKELHLDHSKVNIHGGALALGHPLGASGARILGTLAHSLISENKER
GIASLCIGGGLAIAFEIERGK
NT seq 1146 nt NT seq  +upstreamnt  +downstreamnt
atgcaagacatttatattatcgccgcaaagagaacaccttttggtcgttatcgtggtcag
ttagcagcttttaatgccgtagagttagggacttatgcccttaaagacgccttgaaggct
gctaatttgcgttctagtgacttagatgccttatttatgggaaatgttttaagtgcagga
cttggacagaatatggctcgtcaagttgctattaatagcgggatgagagaagaaagtgtt
gctacaacaattaatgaagtatgtggatcttcacttaaggctgttcgtttagcccaagct
caaatgcttattggcgatttagatcttgtcgcagttggtggtagtgagagtatgactaat
gcgccacttctagctaaaaaatccgaaaaagataatcccaattttgttgatagtatgctc
aatgatggtctaactgattcatttagcaacaagttaatgggaaatacttgtgaaaatgtc
gctgttaaatatgggataagtcgcgctgaagcagatgaatttagtgtgaattcacatcaa
aaagcagctcgcgcacaagctgctggcttctttaatcaagaaattactcctttggcagaa
ttagatcatgatgaaaatgtacggccagattcaaatgttgaaaagttagctagtttgaag
acggtctttaaagaaggtggtgttgctacagctggtaactcatcacctttatcagatggg
gcaagtatgttaattttagctactgaagataaggttaaagaattgaacttaaagccactt
gccaagttaactgcctatgctgaagtggggcttgatccacaaattatgggctttggtcct
aaagtggttattgagaaattattgcaagaaaatgggcaaactctagctgatattgacttg
tttgaaattaatgaagcttttgctgcaactagtctagctgttgaaaaagaattgcacttg
gatcatagtaaggttaatattcatggtggagccttagcattgggacatccattaggagca
agtggtgcgagaattttaggtactttagctcattctttaattagtgaaaataaagaaaga
ggaattgccagcctttgtattggaggcgggctagcaattgcctttgagattgaacggggg
aaataa

DBGET integrated database retrieval system