KEGG   Lactobacillus johnsonii FI9785: FI9785_1074Help
Entry
FI9785_1074       CDS       T01120                                 

Definition
hypothetical protein
Orthology
K00001  
alcohol dehydrogenase [EC:1.1.1.1]
Organism
ljf  Lactobacillus johnsonii FI9785
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:ljf00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    FI9785_1074
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    FI9785_1074
  Lipid metabolism
   00071 Fatty acid degradation
    FI9785_1074
  Amino acid metabolism
   00350 Tyrosine metabolism
    FI9785_1074
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    FI9785_1074
   00626 Naphthalene degradation
    FI9785_1074
Enzymes [BR:ljf01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     FI9785_1074
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1004693..1004938)
Genome map
AA seq 81 aa AA seqDB search
MGVPHAEPKSNQLFWKNVGLRGGIASVTKPDKEVLLQAALDGKINLGKVFTKIFDLDHIQ
DAYKAMSNRDAIKSLIIVNDK
NT seq 246 nt NT seq  +upstreamnt  +downstreamnt
gtgggtgtaccacatgcagaacctaagtcaaaccaattattctggaagaatgtaggtttg
cgtggtggtattgcttctgtaactaaacctgataaagaagttttattacaagcagctctt
gatggtaaaattaatctaggtaaggtatttaccaagatttttgatttagatcatattcaa
gatgcgtataaagcaatgagtaatcgtgatgcaattaagtcgttgatcattgttaatgat
aagtag

DBGET integrated database retrieval system