KEGG   Lactobacillus johnsonii FI9785: FI9785_1074Help
Entry
FI9785_1074       CDS       T01120                                 

Definition
hypothetical protein
Orthology
K00001  
alcohol dehydrogenase [EC:1.1.1.1]
Organism
ljf  Lactobacillus johnsonii FI9785
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Class
Metabolism; Overview; Degradation of aromatic compounds [PATH:ljf01220]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:ljf00010]
Metabolism; Lipid metabolism; Fatty acid degradation [PATH:ljf00071]
Metabolism; Amino acid metabolism; Tyrosine metabolism [PATH:ljf00350]
Metabolism; Xenobiotics biodegradation and metabolism; Chloroalkane and chloroalkene degradation [PATH:ljf00625]
Metabolism; Xenobiotics biodegradation and metabolism; Naphthalene degradation [PATH:ljf00626]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1004693..1004938)
Genome map
AA seq 81 aa AA seqDB search
MGVPHAEPKSNQLFWKNVGLRGGIASVTKPDKEVLLQAALDGKINLGKVFTKIFDLDHIQ
DAYKAMSNRDAIKSLIIVNDK
NT seq 246 nt NT seq  +upstreamnt  +downstreamnt
gtgggtgtaccacatgcagaacctaagtcaaaccaattattctggaagaatgtaggtttg
cgtggtggtattgcttctgtaactaaacctgataaagaagttttattacaagcagctctt
gatggtaaaattaatctaggtaaggtatttaccaagatttttgatttagatcatattcaa
gatgcgtataaagcaatgagtaatcgtgatgcaattaagtcgttgatcattgttaatgat
aagtag

DBGET integrated database retrieval system