KEGG   Lactobacillus johnsonii FI9785: FI9785_1074Help
Entry
FI9785_1074       CDS       T01120                                 

Definition
(GenBank) unnamed protein product
  KO
K00001  alcohol dehydrogenase [EC:1.1.1.1]
Organism
ljf  Lactobacillus johnsonii FI9785
Pathway
ljf00010  Glycolysis / Gluconeogenesis
ljf00071  Fatty acid degradation
ljf00350  Tyrosine metabolism
ljf00625  Chloroalkane and chloroalkene degradation
ljf00626  Naphthalene degradation
ljf01100  Metabolic pathways
ljf01110  Biosynthesis of secondary metabolites
ljf01120  Microbial metabolism in diverse environments
ljf01130  Biosynthesis of antibiotics
ljf01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:ljf00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    FI9785_1074
  Lipid metabolism
   00071 Fatty acid degradation
    FI9785_1074
  Amino acid metabolism
   00350 Tyrosine metabolism
    FI9785_1074
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    FI9785_1074
   00626 Naphthalene degradation
    FI9785_1074
Enzymes [BR:ljf01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     FI9785_1074
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: CAX66940
UniProt: D0R4C7
Position
complement(1004693..1004938)
Genome map
AA seq 81 aa AA seqDB search
MGVPHAEPKSNQLFWKNVGLRGGIASVTKPDKEVLLQAALDGKINLGKVFTKIFDLDHIQ
DAYKAMSNRDAIKSLIIVNDK
NT seq 246 nt NT seq  +upstreamnt  +downstreamnt
gtgggtgtaccacatgcagaacctaagtcaaaccaattattctggaagaatgtaggtttg
cgtggtggtattgcttctgtaactaaacctgataaagaagttttattacaagcagctctt
gatggtaaaattaatctaggtaaggtatttaccaagatttttgatttagatcatattcaa
gatgcgtataaagcaatgagtaatcgtgatgcaattaagtcgttgatcattgttaatgat
aagtag

DBGET integrated database retrieval system