KEGG   Lactobacillus johnsonii FI9785: FI9785_1130Help
Entry
FI9785_1130       CDS       T01120                                 

Gene name
pfk
Definition
hypothetical protein
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
ljf  Lactobacillus johnsonii FI9785
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:ljf00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    FI9785_1130 (pfk)
   01230 Biosynthesis of amino acids
    FI9785_1130 (pfk)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    FI9785_1130 (pfk)
   00030 Pentose phosphate pathway
    FI9785_1130 (pfk)
   00051 Fructose and mannose metabolism
    FI9785_1130 (pfk)
   00052 Galactose metabolism
    FI9785_1130 (pfk)
  Energy metabolism
   00680 Methane metabolism
    FI9785_1130 (pfk)
Enzymes [BR:ljf01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     FI9785_1130 (pfk)
Protein phosphatases and associated proteins [BR:ljf01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     FI9785_1130 (pfk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1064588..1065547)
Genome map
AA seq 319 aa AA seqDB search
MKRIGILTSGGDAPGMNAAIRAVTRTALANGIEVCGIRYGYAGLVAGDIFQMTSETVADK
ISRGGTFLYSARFPEFKEEEVQLKGIEQLKKHGIDALVVIGGDGSYHGALKLTRHGYNAI
GLPGSIDNDIPYTDYTIGFDTACNTAMEAIDKIRDTATSHQRVFVVNVMGRDCGDIAMHV
GVATGADAIVIPEEPYDIKEIAENLKQGFANGKKHGIVVLAEGVMDAEKFKDELLKYGDF
DARANVLGHMQRGGSPTMRDRVLASEMGAYAVKLLLEGKGGLAVGMENNKLTHHDILDLF
DAKHHGNYALYSLNKDLAK
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atgaaacggattggtattttaactagtggtggagatgcccctggtatgaacgctgccatt
agagctgttactcgtacagctttggcaaacggtatcgaagtttgcggaattcgttatgga
tacgctggtttagttgctggtgatattttccaaatgacttctgaaacagttgcggataaa
attagccgcggcggtacttttctttattcagctcgtttcccagaatttaaggaagaagaa
gttcaacttaagggaatcgaacaattaaagaagcacggaatcgatgctttagttgtcatt
ggtggtgacggttcttaccacggtgcattgaagcttacaagacatggctataatgctatt
ggtcttcctggttcaattgacaacgatattccttatactgattatacaattggttttgac
actgcatgtaatactgcaatggaagccattgataagattcgtgacactgcaacaagtcac
caacgtgtatttgttgtaaatgttatgggtcgtgattgtggggatatcgcaatgcacgtt
ggcgttgctaccggtgctgacgcaattgttattccagaagaaccttatgacattaaggaa
attgctgaaaacttgaagcaaggatttgctaatggtaagaaacatggaatcgttgtttta
gctgaaggtgttatggacgctgaaaaatttaaggatgaacttcttaaatatggtgacttt
gacgctcgtgctaatgtattgggccatatgcaacgtggcggaagcccaacaatgcgtgac
cgtgtattagcaagtgaaatgggtgcctacgctgttaagttattacttgaaggtaagggc
ggcttagctgttggtatggaaaacaacaagcttactcaccatgatattcttgatttgttt
gatgcaaaacaccacggtaattatgcgttatactcattaaacaaagacttagccaagtag

DBGET integrated database retrieval system