KEGG   Lactobacillus johnsonii FI9785: FI9785_1215Help
Entry
FI9785_1215       CDS       T01120                                 

Definition
ATP-dependent RecD/TraA family DNA helicase (EC:3.1.11.5)
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
ljf  Lactobacillus johnsonii FI9785
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:ljf03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1142215..1144590)
Genome map
AA seq 791 aa AA seqDB search
MAETSFTGRINGIVFENNQDLFKIIDVDLISKLPDYDRDNIRVTGNFGDIQIGSTYKFTG
NIVVHEKFGKQFRISSYEPVLPHEEGSLAKYLSSDKFPGIGKRAAEKIIDSLGTNALDLI
KSNPTEIDNLDLTQKQKDSLLSGINQMDSFSEIVIKLARYGINKKVAGNIYKVYHGDSLK
KLEEDPYQALGEVRGFGFKTADNMGRLLGIELNDPRRVRGALLSILQTALNTLGDTYVAL
DELLTQAYDLVQSTSYDELANSVNELQRQGKVVVSGDKAALQTIFQTELDIATELKHVVN
NQVEKEEFDDSDIEKAIKHVEETLEIEYDDTQKNAIKNALNNPISILTGGPGTGKTTIIN
GILMCLKELAEIPSAALYSDDPPFLLAAPTGRAAKRMSEVTDISAKTIHRLLGLGIGEND
ATDVNELNGEILIIDEMSMVDMFLFKQLLSGINSTKRIVFVGDKDQLPSVGAGNVFSDLI
SSGAFPTTRLQVIHRQGEDSSIIKLAHAINDEEAEETIFNKTKNYSFIPCQPSLVGDAID
QIVNLAIKRGFKKDDVQVLGAMYNGQGGITHLNDILQDVMNPLSAKTKVIEAHNESFRIG
DRILQLQNNPEKDIYNGQIGKIIGLNPDDKAKILIADFDGREIEFGIKDLNDITRAYAIT
IHKSQGSEFPLVILNLTMQNYMMLRRNLLYTAITRAEKNLVMVGEKKAYIMALRTPGNDR
KTELAAKIRHELGLKEVENTSNVNAEQEKTKTEVKEENVEPEDYVLTPELIYSGQIDPMI
GMEDIKLEEKR
NT seq 2376 nt NT seq  +upstreamnt  +downstreamnt
atggcagaaactagttttactggacgaataaatggaattgtttttgaaaacaatcaagat
cttttcaagattattgatgtagatttaatcagtaaattacctgattacgatcgtgataat
atccgagtaactggaaattttggggatattcaaattggatcaacctataaatttaccggt
aatattgttgtacacgaaaaatttggtaaacaatttcgtataagttcttatgaaccagtt
ttgcctcatgaagagggtagtttagctaaataccttagttctgataagtttcctggaatt
ggtaagagggctgctgaaaagatcattgatagtttaggaacaaatgctttagatctgatt
aagtcgaatccaaccgaaattgacaatcttgatttaactcaaaagcaaaaggatagctta
ttatctggaatcaatcaaatggattctttttcagagattgtaattaagctggctagatat
gggattaacaaaaaagtagctggtaatatttataaagtatatcatggtgattccttgaag
aaattggaggaagacccttaccaagctctgggtgaagttcgtggctttggttttaaaact
gcagataatatgggacggctactaggaattgaactaaatgatcctaggagagttagagga
gcacttctaagtattttacagactgcgcttaataccttgggagatacttatgttgcactt
gatgaattattaacacaagcttatgatttagttcaatctacctcttatgatgagcttgct
aatagtgttaatgaacttcaaaggcaaggaaaagttgttgtttcaggtgataaggcagct
ttgcagacaatttttcaaactgaacttgatatagcaactgaattaaaacatgtagttaat
aatcaagtcgaaaaagaagaatttgatgatagcgatattgaaaaagcaataaaacatgtc
gaagaaacacttgaaatcgaatatgatgatactcaaaaaaatgcaattaaaaacgcgcta
aataatccaatttcgattcttacgggtggtcctggtactggtaaaacgacaattatcaat
ggaattttaatgtgtttaaaggaacttgcggaaattccaagtgcagctttgtatagcgat
gatccaccatttttacttgctgcaccaacgggtcgagcagccaaacgaatgagcgaggtt
acagatatttcagcaaaaaccattcaccgtttattagggttaggcattggtgaaaatgat
gcaactgatgtaaacgaattaaatggtgagattttaataattgatgaaatgtcgatggtt
gatatgtttctctttaaacagcttttatccggtattaattcaacaaagaggatagttttt
gttggggacaaagaccagctcccttcagttggagcggggaatgtttttagtgatttgata
agttcaggagcctttcccacgacacgattgcaagtgattcatagacagggagaagattcc
tcgattattaagttggcccatgcaattaatgatgaagaagcagaagagactatttttaat
aaaactaaaaactattcctttattccatgtcaaccaagcttggtgggggatgcaatcgat
caaatcgtaaatttggctattaaacgtggtttcaaaaaggatgatgttcaagttctggga
gcaatgtacaacggtcaaggtggaattactcacttgaatgatattttgcaggatgtgatg
aatccactatcagcaaaaactaaagtaattgaagctcacaatgaaagttttagaatcggg
gaccgaattctacaattacaaaataatccagaaaaagatatttataatggtcaaattggt
aaaattattggccttaatcctgatgataaggccaaaatattaattgctgattttgatggt
cgtgaaatagaatttggtattaaagacttaaatgatattacccgtgcgtatgccattacc
atccataagtcccaaggatcagaatttccgttagtaattttaaaccttacgatgcaaaat
tatatgatgttgaggcggaatttgttatatactgccattactcgtgccgaaaaaaaccta
gttatggtaggagaaaaaaaggcatatattatggcattgcgtactccaggtaatgaccgt
aagactgagttagcagctaaaattaggcatgagttaggtttaaaagaagttgaaaatact
tcaaatgtaaatgcggaacaagaaaaaactaaaactgaagttaaagaggaaaatgttgag
ccagaagattatgttttgactcctgagctaatttattctggacagattgatccaatgatt
ggaatggaagatattaaattagaagaaaaaagatag

DBGET integrated database retrieval system