KEGG   Lactobacillus johnsonii FI9785: FI9785_1280Help
Entry
FI9785_1280       CDS       T01120                                 

Definition
hypothetical protein
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
ljf  Lactobacillus johnsonii FI9785
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:ljf00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    FI9785_1280
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    FI9785_1280
Enzymes [BR:ljf01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.13  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate---2,6-diaminopimelate ligase
     FI9785_1280
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1203106..1204458
Genome map
AA seq 450 aa AA seqDB search
MNLKSGIAKVAGKSSYWFLHNVLKGGTSFPGKFAMKIDPKVLNSLAKGYETIIVTGTNGK
TMTTALIVEALKKKYGDILTNPSGSNMQQGIVTAFLAHKNKRAKKKIAVLEVDEANVKMV
TELLHPSVFVLTNIFRDQMDRYGEIYTTYQKIVDGIKLAPDATIIANGDASIFSSVELPN
KKVFYGFKLPEDKPENDFKAPVNTDGVLCPKCDHILHYHERIYANLGDYFCPNCGYHRPE
LTYSVNQIIDQTPNSLKFKMGEKEYSIGIGGTYNIYNALAAYSVAREFGLSEEEVAQSFA
ENKRIFGRQELINYADKEIDLILVKNPVGLDEVLHMLNTEKDNYSLVTLLNANHADGIDT
SWIWDADYEGLNKDQIKKVIVGGKRWHDMGFRLEVSGFDPGLMTTATNNEALLDEISKLP
TKKVYILATYTAMLSLRKTMGEKKIIKAGM
NT seq 1353 nt NT seq  +upstreamnt  +downstreamnt
atgaatttaaaatcaggcatcgctaaggtagctggtaaatcatcttactggtttcttcat
aacgtattaaagggcgggacgagttttcctgggaaatttgccatgaaaattgatcctaaa
gtattaaattcattagcaaaaggctatgagacaatcattgttactggaactaatggtaaa
acaatgacaactgctttaatcgtggaagcattaaagaagaaatatggtgatattttaact
aatccatcaggctcaaatatgcaacaaggaattgttacagcatttttagctcacaagaat
aaaagagcaaaaaagaaaattgctgtgctagaagtagatgaagcaaatgtaaaaatggta
accgagttactgcatccaagcgtatttgttttaactaatatttttcgcgatcagatggat
agatatggtgaaatttatactacctaccaaaagattgtcgatggaattaaactagctccc
gatgcaactattatcgctaacggggatgcaagtattttttcatccgtggaattacctaat
aaaaaagtattctatggtttcaaacttcccgaagacaaacctgaaaatgacttcaaggct
cccgtaaatactgacggtgttttatgtcctaagtgtgatcatatcttgcattatcacgaa
cgtatttatgcaaacttaggagactatttctgccctaattgtggctaccatcgtccagaa
ttaacctatagtgtaaatcaaattattgatcaaactccaaatagcttaaaattcaaaatg
ggtgaaaaagagtacagcattggtatcggtggtacctacaatatctataatgctctagct
gcttattctgtagcgcgtgaatttggtttaagtgaagaagaagtagcccaaagttttgct
gaaaacaaacgaatctttggtcgccaagaattgattaattatgcagataaagaaatagat
ctcatcttagttaaaaatccagttggacttgatgaagttctccatatgttaaatactgaa
aaagataactactctttagttactcttttaaatgcaaatcacgcagacggaatcgataca
tcctggatctgggatgcagattacgaaggattaaataaagatcaaatcaaaaaagtaata
gtcggtggaaaacgttggcatgatatgggatttagactagaagtttccggcttcgatccg
ggtttaatgacaactgccactaataatgaagctttattagatgaaatttcaaaattacca
actaagaaagtttatattttagctacttatactgctatgctttcacttcgtaaaacaatg
ggtgaaaagaaaattattaaagcaggtatgtaa

DBGET integrated database retrieval system