KEGG   Lactobacillus johnsonii FI9785: FI9785_1334Help
Entry
FI9785_1334       CDS       T01120                                 

Gene name
tpi
Definition
hypothetical protein
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
ljf  Lactobacillus johnsonii FI9785
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Class
Metabolism; Overview; Carbon metabolism [PATH:ljf01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:ljf01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:ljf00010]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:ljf00051]
Metabolism; Carbohydrate metabolism; Inositol phosphate metabolism
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1253343..1254098)
Genome map
AA seq 251 aa AA seqDB search
MRTPIIAGNWKLHMNPEQTIEFVNAVKGKLPDPSKVESVIAAPAVDLYVLKKTAEGSNLH
TGAENAYFEIEGAFTGETSPKVLNEMGIDYCIIGHSERRGYFHETDEDINKKAKALFANG
VTPIICCGESLETREANKQDEWVVAQIKAALDGLTAEQVSKLVIAYEPIWAIGTGKTASA
DQAEEMCKTIRETVKDLYNEETAENVRIQYGGSVKPANVKELMSKPDIDGGLVGGASLDP
ESFLALVNYQD
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atgcgtacaccaattattgctggtaactggaaattacacatgaaccctgaacaaaccatt
gaatttgttaatgcagttaagggtaagctgccagatccaagtaaagttgaatcagttatt
gctgcacctgcagttgatctttatgttttaaagaagactgctgaaggctcaaacttacat
actggtgcagaaaatgcatactttgaaattgaaggtgcctttactggtgaaacttcacct
aaagttttgaatgaaatgggtattgactactgtattattggtcactcagaacgtcgtggt
tacttccacgaaactgatgaagacattaacaagaaagctaaggctttatttgctaatggc
gtaactccaattatttgctgtggtgaatctcttgaaactcgtgaagctaacaagcaagat
gaatgggtagtagctcaaattaaagctgctttagatggattaactgcagaacaagtttct
aaacttgttattgcttacgaaccaatttgggctatcggtactggtaagactgcttctgct
gatcaagctgaagaaatgtgcaagactattcgtgaaactgtaaaagacttgtacaatgaa
gaaactgctgaaaatgttcgtatccaatacggtggttcagtaaaaccagctaacgtaaaa
gaattaatgtctaagcctgacattgatggtggtttagttggtggtgcttctcttgatcca
gaatcattcttagcattagtaaactaccaagattaa

DBGET integrated database retrieval system