KEGG   Lactobacillus johnsonii FI9785: FI9785_1334Help
Entry
FI9785_1334       CDS       T01120                                 

Gene name
tpi
Definition
(RefSeq) hypothetical protein
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
ljf  Lactobacillus johnsonii FI9785
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:ljf00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    FI9785_1334 (tpi)
   01230 Biosynthesis of amino acids
    FI9785_1334 (tpi)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    FI9785_1334 (tpi)
   00051 Fructose and mannose metabolism
    FI9785_1334 (tpi)
   00562 Inositol phosphate metabolism
    FI9785_1334 (tpi)
Enzymes [BR:ljf01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     FI9785_1334 (tpi)
Exosome [BR:ljf04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   FI9785_1334 (tpi)
  Exosomal proteins of bladder cancer cells
   FI9785_1334 (tpi)
  Exosomal proteins of melanoma cells
   FI9785_1334 (tpi)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1253343..1254098)
Genome map
AA seq 251 aa AA seqDB search
MRTPIIAGNWKLHMNPEQTIEFVNAVKGKLPDPSKVESVIAAPAVDLYVLKKTAEGSNLH
TGAENAYFEIEGAFTGETSPKVLNEMGIDYCIIGHSERRGYFHETDEDINKKAKALFANG
VTPIICCGESLETREANKQDEWVVAQIKAALDGLTAEQVSKLVIAYEPIWAIGTGKTASA
DQAEEMCKTIRETVKDLYNEETAENVRIQYGGSVKPANVKELMSKPDIDGGLVGGASLDP
ESFLALVNYQD
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atgcgtacaccaattattgctggtaactggaaattacacatgaaccctgaacaaaccatt
gaatttgttaatgcagttaagggtaagctgccagatccaagtaaagttgaatcagttatt
gctgcacctgcagttgatctttatgttttaaagaagactgctgaaggctcaaacttacat
actggtgcagaaaatgcatactttgaaattgaaggtgcctttactggtgaaacttcacct
aaagttttgaatgaaatgggtattgactactgtattattggtcactcagaacgtcgtggt
tacttccacgaaactgatgaagacattaacaagaaagctaaggctttatttgctaatggc
gtaactccaattatttgctgtggtgaatctcttgaaactcgtgaagctaacaagcaagat
gaatgggtagtagctcaaattaaagctgctttagatggattaactgcagaacaagtttct
aaacttgttattgcttacgaaccaatttgggctatcggtactggtaagactgcttctgct
gatcaagctgaagaaatgtgcaagactattcgtgaaactgtaaaagacttgtacaatgaa
gaaactgctgaaaatgttcgtatccaatacggtggttcagtaaaaccagctaacgtaaaa
gaattaatgtctaagcctgacattgatggtggtttagttggtggtgcttctcttgatcca
gaatcattcttagcattagtaaactaccaagattaa

DBGET integrated database retrieval system