KEGG   Lactobacillus johnsonii FI9785: FI9785_1400Help
Entry
FI9785_1400       CDS       T01120                                 

Gene name
mvaC
Definition
(GenBank) mvaC
  KO
K00626  
acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
ljf  Lactobacillus johnsonii FI9785
Pathway
Fatty acid degradation
Synthesis and degradation of ketone bodies
Valine, leucine and isoleucine degradation
Lysine degradation
Benzoate degradation
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Propanoate metabolism
Butanoate metabolism
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Fatty acid metabolism
Two-component system
Brite
KEGG Orthology (KO) [BR:ljf00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    FI9785_1400 (mvaC)
   00630 Glyoxylate and dicarboxylate metabolism
    FI9785_1400 (mvaC)
   00640 Propanoate metabolism
    FI9785_1400 (mvaC)
   00650 Butanoate metabolism
    FI9785_1400 (mvaC)
  Lipid metabolism
   00071 Fatty acid degradation
    FI9785_1400 (mvaC)
   00072 Synthesis and degradation of ketone bodies
    FI9785_1400 (mvaC)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    FI9785_1400 (mvaC)
   00310 Lysine degradation
    FI9785_1400 (mvaC)
   00380 Tryptophan metabolism
    FI9785_1400 (mvaC)
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    FI9785_1400 (mvaC)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    FI9785_1400 (mvaC)
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    FI9785_1400 (mvaC)
Enzymes [BR:ljf01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     FI9785_1400 (mvaC)
Exosome [BR:ljf04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   FI9785_1400 (mvaC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(1325409..1326575)
Genome map
AA seq 388 aa AA seqDB search
MLQDVYIVGMNRIPFGKYRGFYKNKSAVDLGVLALKGLLKKNIVPQDKIDSILVGNVLSA
GLGQNVARQIALKSGLPESVVGTSVDDVCGSSLKALRFAQGQMLLGDSQIAIVGGAESMT
NAPLLLDKSKKHDENPAYQDSLMIDGIGDAYSRKPMGITAENVADKYHITRQDMDEFARD
SHAKAYAAQENNWFEEEYAPIELDGNVLDHDETIRPDSSLEALGQLKPVFKENGRVTAGN
SSPLTDGASMLLLSNQQKLDELNLTPLAYLGAYAEIGCDPAYMGYAPYFAIKELLTKTNS
TIEDYDLIEINEAFAAQAYAVARDLNIPKEKLNIAGGAISLGHPLGATGTRLVMSAVNGL
RKINGRRAIVSLCIGGGQGIAYEIRRII
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
gtgttacaggatgtttatatagtaggaatgaatcgaattccttttggtaagtatcgtgga
ttttataagaataaaagtgctgttgacctaggagtattagcacttaagggattattgaaa
aagaatattgttccacaagataaaatagatagcattttggtgggaaatgtattaagtgct
gggctaggtcaaaatgtcgctcgacaaatagctttaaaatcaggtttacctgaatctgta
gtgggtactagcgtagacgatgtttgtggttcaagtttaaaggcattacggtttgctcaa
ggtcaaatgctcctaggagattctcaaattgcaattgtaggtggggcagaaagtatgaca
aatgcaccacttttacttgataaaagtaaaaagcatgatgaaaatccagcatatcaagat
agtttaatgatagatggaattggggatgcttattcgagaaagccaatgggaattacagct
gagaatgtagctgataaataccatattacgcgtcaagatatggatgaatttgcgcgtgat
tcccacgccaaggcttatgcagctcaagagaacaactggtttgaggaagagtatgcacca
attgaactcgatggtaatgttcttgatcatgatgaaaccattcgaccagattctagttta
gaagcattaggtcaattaaaacctgtatttaaagaaaatggacgagttacggctggtaat
tcttctccgctaactgatggtgcaagtatgttgttattatctaatcaacaaaaattagat
gagttaaatttaaccccattagcatacctaggtgcctatgcagaaattggctgtgatcct
gcctatatgggctatgcgccatactttgccattaaagaattacttacaaaaactaatagc
acaattgaagattacgatcttattgaaattaatgaagcctttgcagctcaagcatatgct
gtagcccgtgatctaaatattccaaaagaaaaattaaatatcgctggaggagcaattagt
ttaggacatccgcttggtgcaaccggtacgcgcttggtaatgagtgcagtaaatggtttg
cgcaaaattaatggtcgaagagcaattgtatctctatgtatcggcggtggccaaggaatc
gcatatgaaattagaagaatcatctaa

DBGET integrated database retrieval system