KEGG   Lactobacillus johnsonii FI9785: FI9785_1629Help
Entry
FI9785_1629       CDS       T01120                                 

Gene name
gmk
Definition
(GenBank) putative guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
ljf  Lactobacillus johnsonii FI9785
Pathway
ljf00230  Purine metabolism
ljf01100  Metabolic pathways
Module
ljf_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:ljf00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    FI9785_1629 (gmk)
Enzymes [BR:ljf01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     FI9785_1629 (gmk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin AAA_18 AAA_22 AAA_17 SKI ADK Thymidylate_kin dNK PRK MMR_HSR1 ABC_tran RsgA_GTPase AAA_5 AAA_33 AAA_16 LacI AAA_28 Rad17 AAA_24 AAA_14 DUF1100 Cytidylate_kin AAA TsaE RNA_helicase RuvB_N T2SSE AAA_30
Motif
Other DBs
NCBI-ProteinID: CAX67482
UniProt: D0R5W9
Position
complement(1568294..1568914)
Genome map
AA seq 206 aa AA seqDB search
MFYNSEILLYIIVDFKQESNILQRIIIIAGPSGVGKTTVSKYLTEKYNIPRVVTHTTRPI
RQGEIPGKSYYFETDESFKKLHFFEHVKYGEYQYGSSKEALEKAWAKNDLVSLIVETDGV
KSYLEKLGKQAYFIYLTVSDFSVLKKRLLRRGDKASEIDKRLNSFEFKRDLHLSDELAKK
AHVLNNDNWEKTAKELDKIVKKLENK
NT seq 621 nt NT seq  +upstreamnt  +downstreamnt
atgttttacaatagtgaaatactattatatataatagtcgatttcaagcaggagagtaat
attttgcaaagaattatcataattgcgggaccaagtggagtaggaaaaacaacagtctca
aaatacttaacggaaaaatataatattccgcgtgtagtaacacatactactaggccaatt
agacaaggagaaattccggggaagtcatattattttgaaactgatgagagttttaaaaaa
cttcatttttttgaacatgtaaaatatggggaatatcaatatggatccagtaaagaagct
ttagaaaaagcctgggcaaagaatgacttggtttctttaattgttgagactgacggagtt
aagtcctatttagaaaaattaggaaagcaagcatattttatttatttaactgtttcagat
ttttcagttctaaaaaagcgattattaagacgcggagataaagctagtgaaattgataag
agattaaatagttttgaatttaagcgtgatttacatttgtcagatgaacttgctaaaaaa
gcacatgtattaaataatgacaactgggaaaagacagctaaagaactagataagatcgta
aaaaagctggaaaataaatag

DBGET integrated database retrieval system