KEGG   Lactobacillus johnsonii FI9785: FI9785_1689Help
Entry
FI9785_1689       CDS       T01120                                 

Definition
hypothetical protein
Orthology
K15634  
probable phosphoglycerate mutase [EC:5.4.2.12]
Organism
ljf  Lactobacillus johnsonii FI9785
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:ljf00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    FI9785_1689
   01230 Biosynthesis of amino acids
    FI9785_1689
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    FI9785_1689
  Energy metabolism
   00680 Methane metabolism
    FI9785_1689
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    FI9785_1689
Enzymes [BR:ljf01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.12  phosphoglycerate mutase (2,3-diphosphoglycerate-independent)
     FI9785_1689
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1623626..1624252)
Genome map
AA seq 208 aa AA seqDB search
MDLLLVRHGVSEHNTSDVISGGTSNPNLSQAGVKQVEEVSKLIDNSKLDRVYASPLIRAK
RTAQILTDFQKEIITDDRLREMNFGSWDGQHAEELKIKYPDAFDDLGTINSKYAEYAENG
ETFSQVADRVEEFLSEIQPDANDKTIMIVCHGFVIRSLIARWFKLKIEDVMTVRNVSFTE
LHFEKNDIERPRLMTFNRTEPLYYGLKR
NT seq 627 nt NT seq  +upstreamnt  +downstreamnt
atggatttgttattagtaagacatggggttagtgaacataatacttcagatgtgatctcc
ggcggtactagtaaccctaacttaagccaagcaggtgttaaacaagtagaagaagtaagt
aagttaattgacaatagtaaacttgatcgagtatatgcaagcccattaattagagctaaa
agaacagcacaaattttaactgattttcaaaaagagattattactgatgatcgacttaga
gaaatgaattttggctcttgggacggccaacatgccgaagagctgaagataaaatatcct
gatgccttcgatgatttaggaactattaatagtaaatatgcagaatacgctgaaaatggt
gaaacttttagtcaagtagcagatcgagttgaagaatttttatctgagattcaacccgat
gctaatgacaagacaattatgattgtttgtcacggatttgtgattaggagtttaatagct
cggtggtttaaactaaaaattgaagatgtaatgacagtaagaaatgttagttttactgag
cttcattttgaaaaaaatgatattgagcgaccaagattaatgacctttaatcggacggaa
cccttgtattacggacttaagaggtaa

DBGET integrated database retrieval system