KEGG   Lactobacillus johnsonii FI9785: FI9785_233Help
Entry
FI9785_233        CDS       T01120                                 

Gene name
gpm
Definition
phosphoglycerate mutase (EC:5.4.2.1)
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
ljf  Lactobacillus johnsonii FI9785
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:ljf00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    FI9785_233 (gpm)
   01230 Biosynthesis of amino acids
    FI9785_233 (gpm)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    FI9785_233 (gpm)
  Energy metabolism
   00680 Methane metabolism
    FI9785_233 (gpm)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    FI9785_233 (gpm)
Enzymes [BR:ljf01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     FI9785_233 (gpm)
Exosome [BR:ljf04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   FI9785_233 (gpm)
  Exosomal proteins of melanoma cells
   FI9785_233 (gpm)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
184194..184886
Genome map
AA seq 230 aa AA seqDB search
MSKLVLIRHGQSEWNLSNQFTGWVDVNLSEKGVEEAKKAGRLIKEHGLEFDQAYTSLLTR
AIKTLHYALEESDQLWIPETKTWRLNERHYGALQGLNKKDTAEKYGDEQVHIWRRSYDVL
PPAIDDDNEYSQAHDRRYANLDPHIVPKAENLHVTLDRVMPFWEDHIAPDLLDGKNVIIA
AHGNSLRALTKYIENISDDDIMDLEMKTGEPVVYTFDDKLDVVNKEKLDD
NT seq 693 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaaattagttttaattcgtcacggtcaaagtgaatggaacctttctaaccaattt
actggttgggttgatgtaaacctttcagaaaaaggtgttgaagaagctaagaaggctggt
cgtttaattaaggaacacggtcttgaatttgatcaagcttacacttcattattaactcgt
gctatcaagactttgcactacgcacttgaagaaagtgaccaactttggattcctgaaact
aagacttggagattaaacgaacgtcattacggtgctcttcaaggtttaaacaagaaggat
actgctgaaaagtacggtgacgaacaagttcacatttggcgtcgttcatacgatgttttg
ccaccagctattgatgacgataacgaatacagtcaagcacatgaccgtcgttacgcaaat
cttgatccacatatcgttcctaaggccgaaaacttacacgttactttagatcgtgtaatg
ccattctgggaagatcacattgctccagatttacttgacggcaagaacgttattattgct
gcacacggtaactcacttcgtgctttaactaagtacattgaaaacatctctgatgatgac
atcatggacttagaaatgaagactggtgaaccagttgtttacacatttgacgacaagtta
gatgttgttaacaaagaaaagcttgacgactaa

DBGET integrated database retrieval system