KEGG   Lactobacillus johnsonii FI9785: FI9785_260Help
Entry
FI9785_260        CDS       T01120                                 

Definition
6-phospho-beta-glucosidase (EC:3.2.1.86)
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
ljf  Lactobacillus johnsonii FI9785
Pathway
Glycolysis / Gluconeogenesis
Brite
KEGG Orthology (KO) [BR:ljf00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    FI9785_260
Enzymes [BR:ljf01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.86  6-phospho-beta-glucosidase
     FI9785_260
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(206731..208221)
Genome map
AA seq 496 aa AA seqDB search
MNFENAYFRKDVLNMTGYTMPKGFLWGGAVAAHQLEGAWDEDGKGMSVADVMTVGSATKP
REITDGVIPGKNYPNHDAIDFYHHYKGDIKLMAEMGFKAFRTSIAWTRIFPKGDEEEPNE
AGLKFYDDLFDECHKYGIEPVITLSHFEIPYHLVKEYGGFTNRKLIDYFVRFARVCFKRY
KNKVKYWMTFNEIDNQSSFNNDFLMATNSGILFKNGMGDKEKEAAMYQAAHYELVASALA
VKEGHKINPDFQIGCMINYSPVRPLTPSSDDVLLADKFEQRRDFFSDVHVNGEYPNAVED
YIERNGYRPDITEEDKIALKEGTVDYVGFSYYQSTTVSSKKVKPDELTDLQEAIVENPTL
ERSDWGWEIDPEGLRISLNHLTDRYHKPLFIVENGLGAYDKREADGSVHDPYRIDYLRKH
IEQMEKAVVLDGVDLMGYLPWGCIDLVSAGTGQMDKRYGFIYVDKNDKGEGTLERSKKDS
FNWYKKVIESNGKDLD
NT seq 1491 nt NT seq  +upstreamnt  +downstreamnt
atgaatttcgaaaacgcttactttagaaaggacgtattgaatatgactggatacactatg
cctaagggctttttatggggcggcgctgttgccgctcaccaacttgaaggtgcatgggat
gaagatggaaaaggaatgtctgtagctgatgttatgacagtaggatcagcaactaagcca
cgtgaaattactgatggtgttattcctggtaaaaactatcctaatcatgatgccattgat
ttttaccaccactacaagggtgatattaagttaatggctgaaatgggctttaaggctttc
cgtacttcaatagcttggactagaatttttcctaaaggcgatgaagaagaacctaatgaa
gcaggtcttaagttctacgatgacttatttgatgaatgtcataagtatggaattgaacct
gtaattaccctttctcactttgaaattccttatcacttagtcaaagaatatggtggtttt
actaaccgtaaattaattgattactttgttcgctttgcccgtgtttgctttaagcgttac
aagaataaagttaaatactggatgactttcaacgaaattgataatcaatctagttttaac
aatgacttcttaatggccactaactctggtatcttgtttaagaatggaatgggcgataaa
gaaaaagaagcggctatgtatcaagctgcccattatgaattagttgcttctgctttagca
gttaaagaaggtcataagattaatccagacttccaaattggttgtatgattaactactca
cctgttcgtcctttaactccatcatcagatgatgttttacttgctgataagtttgaacaa
agacgtgacttcttctccgatgtacacgttaacggtgaatatccaaatgctgttgaagat
tacattgaaagaaatggctaccgtccagatatcaccgaagaagataagattgccttaaaa
gaaggtacagtagactacgttggtttctcatactatcaatccactactgtttcaagtaag
aaagttaaaccagatgaattaactgacttacaagaagctatcgtcgaaaaccctacttta
gagcgtagtgactggggttgggaaattgacccagaaggtttgagaatttctcttaatcac
ttaactgaccgctaccacaagccactatttatcgttgaaaatggtctcggtgcttacgac
aagcgcgaagctgacggttcagttcatgatccatatcgaatcgattacttgagaaaacac
attgaacaaatggaaaaggccgttgtgttagacggtgttgacttgatgggttatcttcct
tggggatgcatcgacttagtttcagctggaacgggtcaaatggacaagcgttatggtttc
atctatgttgacaagaatgacaagggtgaaggaacgctagaacgctcaaagaaggattca
tttaactggtataagaaagttattgaatctaacggtaaagatttagactaa

DBGET integrated database retrieval system