KEGG   Lactobacillus johnsonii FI9785: FI9785_308Help
Entry
FI9785_308        CDS       T01120                                 

Gene name
res
Definition
type III restriction-modification system restriction subunit
Orthology
K01156  
type III restriction enzyme [EC:3.1.21.5]
Organism
ljf  Lactobacillus johnsonii FI9785
Brite
Enzymes [BR:ljf01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.21  Endodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.21.5  type III site-specific deoxyribonuclease
     FI9785_308 (res)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
260632..263253
Genome map
AA seq 873 aa AA seqDB search
MKKENLKPFPTLEKAKEEVNSFLNQLPNLYYIDENLKHTLRRYQQSALLYLNWSQKQVDA
NEKYNQLMFNMATGSGKTDVMAAVILYLFKEFKYTNFLFVSNTTAVVDKTKENFLNTASA
KYLFSAPINIDGERIDIKSVESFPINQEPNTIYLKLSTVQSLSNELNDPQENALTFDDLE
KHKIVILADEAHHFNAQTKKNQREETSWENLLDQIRRSNKLNRQLEFTATIDVDKEDVYE
KYKDKIIYKYDLSKFMEEGYSKNVFRLQANNDNMQKLLNAVLLSQYRKRIAQKLEIPNFK
PILLVKSNRIKTSQTVKDDFLSMIENLSTESLNEFLLTNQKLNLSSMALSLTYKYWLSQD
LVKAVSEIKQDFNINTTINVNEGGTKGLLSDNVDFRNLNSLEDIDNPFRIIFAVAKLTEG
WDVLNLYDIVRVSEEKESSTLKQTNSEAQLIGRGARYYPFVYKGDKSYTRRFDNSSSNEK
RLLETLYYHTINDSKYIDNLNKSFDKMDLIVNQDADCQTFSAKVKSKFKQTSFYKNGSLF
YNKTEEVPDSEYKNIGDYGIDNFTMVIDYNLSTTENRLRDDIFQINDSNTRYDNVVEFYN
NDDYRLIKKAIARNKFYRFDNMKRYLPMLSSIKEFIKSQKWLGNLKVMARVPDQYNVDLS
LMEKLSVLDITLRRIQTNIVKSYRKERGTNEFISIAVRDAVKDYSKIVPQPSNKKVVNEL
IQPKKMNDADWFPYDYAITDQLESSLINLISSMVDEFKRKYQNVYLIRNEETISSWKLHE
FENKVTKHYEGYMPDFILVLDNGKIMYQVYVEPKGEQLLEKDAWKEELLESIRPENIDII
GENKDVKLYGVKFYTHGDGRNIVDELHNLNILD
NT seq 2622 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaagaaaatttaaaaccatttccaaccttagagaaggctaaagaagaagtaaat
agttttcttaatcagcttcctaatctttattacatagatgaaaatttaaagcatacctta
agaagatatcaacaatcagctttactttacttgaattggtcgcagaaacaagtagatgct
aatgaaaagtacaatcaattaatgtttaatatggctactggctcaggtaaaactgatgtt
atggctgctgttattttgtatttatttaaagaattcaaatatactaatttcttgtttgtt
tccaataccactgccgtagtagataaaacaaaagaaaactttcttaatacagcttctgca
aaatatcttttttcagctccaataaatattgatggtgaaagaatagatataaaatctgtt
gaatcttttcctatcaaccaagaacctaatacaatatatttaaaactttctactgttcaa
tctttatcaaatgaattgaatgatccacaagaaaatgctttgacttttgatgatctagag
aaacataaaatagttattttggctgatgaagctcatcactttaatgctcaaacaaagaaa
aatcaaagagaagaaacttcttgggaaaatttacttgatcaaataagaagatcaaataaa
ttaaaccgtcaattagaatttacagctacaattgatgttgataaagaagatgtttacgaa
aaatataaagataaaataatttacaagtatgaccttagtaaattcatggaagaaggatat
tctaagaatgtttttcgtttacaggcaaataatgataatatgcaaaaattgcttaatgcc
gttttgcttagtcaataccgtaaacgaatagctcaaaaattagaaattccaaattttaag
ccaattttattggttaaatctaatcgaattaagacatcacaaacagtaaaagatgatttc
ttatctatgattgagaatttatctacagaatcattaaatgaattccttttaaccaatcaa
aagttaaacttaagtagtatggctttgagcttaacctataaatactggttatctcaagat
ctagttaaagcagtatcagaaatcaagcaggattttaatattaatactacgattaacgtt
aatgaaggtggaacaaagggacttctttccgataatgttgattttagaaatttgaattct
ttggaagatattgataacccatttagaattatttttgctgttgcaaagttaactgaaggc
tgggatgttttaaatctctatgatattgttagagtttccgaagaaaaggaatcgagtacg
cttaagcaaactaactcagaagcacaattaattggacgtggagcaaggtattatcctttt
gtttataaaggtgataaatcatatacaagacgatttgataatagttcatctaatgaaaaa
agactactggaaactctttattaccacactattaatgattcaaaatatatcgataatttg
aacaaatcatttgataaaatggatcttattgttaatcaagatgcagactgtcaaacattt
agtgctaaggtaaagtccaaatttaagcaaacaagtttctataagaatggtagtttgttt
tataacaagacagaagaagtgccggactctgaatataaaaacattggtgattatggtatt
gataattttacgatggttatcgattataatttatcaacaactgaaaatagactaagagat
gatatttttcaaattaacgattcaaataccagatatgacaatgtcgtagaattttataat
aacgatgactatcgattgataaagaaggcaattgcaagaaataaattttatcgtttcgat
aatatgaagagatatttacccatgttaagttcaatcaaagaatttattaaatctcaaaag
tggttaggaaacttaaaagttatggcacgagtaccagatcaatataatgttgacctttca
ttaatggaaaagctatctgttttagatattactttacgtaggatacaaacaaatattgta
aaaagttatcgtaaagaacgtggtacaaatgaatttatttctatagctgtaagagatgca
gtgaaagattatagtaaaatagtacctcaaccttctaataaaaaagtagtaaatgaactt
attcaaccaaagaagatgaatgatgcggattggtttccttatgactatgcaattactgac
caactagagtcatctttaattaatctaattagtagtatggttgatgaatttaaacgaaaa
tatcagaatgtttacttaattagaaatgaagagacaatttcaagttggaaactacatgaa
ttcgaaaataaagttactaaacattatgaaggatatatgccagacttcattcttgttctc
gataatggaaaaattatgtatcaagtttatgttgagccaaaaggagaacagcttttagaa
aaagatgcatggaaagaagagcttctagaaagcattagaccggaaaacattgatataatt
ggtgaaaataaagatgttaagctatatggagttaaattttatactcatggtgatggccgt
aacatagtggatgagttgcataatttgaatatcttggactaa

  All links  
No link information was found.   
DBGET integrated database retrieval system