KEGG   Lactobacillus johnsonii FI9785: FI9785_407Help
Entry
FI9785_407        CDS       T01120                                 

Gene name
gpm1
Definition
phosphoglycerate mutase (EC:5.4.2.1)
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
ljf  Lactobacillus johnsonii FI9785
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:ljf00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    FI9785_407 (gpm1)
   01230 Biosynthesis of amino acids
    FI9785_407 (gpm1)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    FI9785_407 (gpm1)
  Energy metabolism
   00680 Methane metabolism
    FI9785_407 (gpm1)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    FI9785_407 (gpm1)
Enzymes [BR:ljf01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     FI9785_407 (gpm1)
Exosome [BR:ljf04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   FI9785_407 (gpm1)
  Exosomal proteins of melanoma cells
   FI9785_407 (gpm1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
350489..351166
Genome map
AA seq 225 aa AA seqDB search
MAKLVLVRHGESIANRDNVYTGWNDVPLSKKGIEQAKNAGLKVEKIAGFVPTHIHTSVLS
RAIMTANIIADVCSFLYLPITKTWRLNERHYGALRGINKDVSKKIFGTKQVLEWRRGFDS
VPPLLTQPVQDRRYQRYDMRLMPQGESLHQTQERLMPYFWDHIAPELMAGHDQLVVAHGS
SLRALIKKIEDISNEDIVKVEVPNAEPIVYTFDTNLHIIKKEILH
NT seq 678 nt NT seq  +upstreamnt  +downstreamnt
ttggccaaattagttttagttaggcatggtgaaagtatagctaatcgtgacaatgtttat
acgggctggaatgatgtgcctttaagtaaaaaggggattgaacaggcaaaaaatgcaggt
cttaaggtggaaaaaatagccggatttgtgccaacgcatattcatacttctgtcttatcg
cgtgcaattatgacagctaatattattgcagatgtttgcagctttttatatttacctatt
actaagacttggcgtttaaatgagcgtcactatggagcacttcgcggtattaataaggat
gtttcaaagaaaatttttggtactaagcaagtcttagaatggagacgtggttttgacagt
gtgcctcctttattaacgcagcccgtgcaagatcgtagatatcaaaggtatgatatgcgt
ctaatgccccaaggagaaagtctacatcaaacgcaggagagattaatgccttatttttgg
gatcatattgcacctgaattaatggcaggtcatgatcaattggttgtagcccatggctca
agtttacgtgccttgattaaaaaaattgaagatatcagtaatgaggatattgtaaaagta
gaagtgcccaatgcagagccaattgtttatacttttgatactaatttgcatattataaag
aaagaaattctacattga

DBGET integrated database retrieval system