KEGG   Lactobacillus johnsonii FI9785: FI9785_407Help
Entry
FI9785_407        CDS       T01120                                 

Gene name
gpm1
Definition
(GenBank) phosphoglycerate mutase
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
ljf  Lactobacillus johnsonii FI9785
Pathway
ljf00010  Glycolysis / Gluconeogenesis
ljf00260  Glycine, serine and threonine metabolism
ljf00680  Methane metabolism
ljf01100  Metabolic pathways
ljf01110  Biosynthesis of secondary metabolites
ljf01120  Microbial metabolism in diverse environments
ljf01130  Biosynthesis of antibiotics
ljf01200  Carbon metabolism
ljf01230  Biosynthesis of amino acids
Module
ljf_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:ljf00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    FI9785_407 (gpm1)
  Energy metabolism
   00680 Methane metabolism
    FI9785_407 (gpm1)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    FI9785_407 (gpm1)
Enzymes [BR:ljf01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     FI9785_407 (gpm1)
Membrane trafficking [BR:ljf04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    FI9785_407 (gpm1)
Exosome [BR:ljf04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   FI9785_407 (gpm1)
  Exosomal proteins of melanoma cells
   FI9785_407 (gpm1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: CAX66290
UniProt: D0R284
Position
350489..351166
Genome map
AA seq 225 aa AA seqDB search
MAKLVLVRHGESIANRDNVYTGWNDVPLSKKGIEQAKNAGLKVEKIAGFVPTHIHTSVLS
RAIMTANIIADVCSFLYLPITKTWRLNERHYGALRGINKDVSKKIFGTKQVLEWRRGFDS
VPPLLTQPVQDRRYQRYDMRLMPQGESLHQTQERLMPYFWDHIAPELMAGHDQLVVAHGS
SLRALIKKIEDISNEDIVKVEVPNAEPIVYTFDTNLHIIKKEILH
NT seq 678 nt NT seq  +upstreamnt  +downstreamnt
ttggccaaattagttttagttaggcatggtgaaagtatagctaatcgtgacaatgtttat
acgggctggaatgatgtgcctttaagtaaaaaggggattgaacaggcaaaaaatgcaggt
cttaaggtggaaaaaatagccggatttgtgccaacgcatattcatacttctgtcttatcg
cgtgcaattatgacagctaatattattgcagatgtttgcagctttttatatttacctatt
actaagacttggcgtttaaatgagcgtcactatggagcacttcgcggtattaataaggat
gtttcaaagaaaatttttggtactaagcaagtcttagaatggagacgtggttttgacagt
gtgcctcctttattaacgcagcccgtgcaagatcgtagatatcaaaggtatgatatgcgt
ctaatgccccaaggagaaagtctacatcaaacgcaggagagattaatgccttatttttgg
gatcatattgcacctgaattaatggcaggtcatgatcaattggttgtagcccatggctca
agtttacgtgccttgattaaaaaaattgaagatatcagtaatgaggatattgtaaaagta
gaagtgcccaatgcagagccaattgtttatacttttgatactaatttgcatattataaag
aaagaaattctacattga

DBGET integrated database retrieval system