KEGG   Lactobacillus johnsonii FI9785: FI9785_417Help
Entry
FI9785_417        CDS       T01120                                 

Gene name
gltX
Definition
glutamyl-tRNA synthetase (EC:6.1.1.17)
Orthology
K09698  
nondiscriminating glutamyl-tRNA synthetase [EC:6.1.1.24]
Organism
ljf  Lactobacillus johnsonii FI9785
Pathway
Aminoacyl-tRNA biosynthesis
Metabolic pathways
Module
Aminoacyl-tRNA biosynthesis, prokaryotes
Brite
KEGG Orthology (KO) [BR:ljf00001]
 Genetic Information Processing
  Translation
   00970 Aminoacyl-tRNA biosynthesis
    FI9785_417 (gltX)
Enzymes [BR:ljf01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.24  glutamate---tRNAGln ligase
     FI9785_417 (gltX)
Amino acid related enzymes [BR:ljf01007]
 Aminoacyl-tRNA synthetase
  Class I (A)
   FI9785_417 (gltX)
Transfer RNA biogenesis [BR:ljf03016]
 Prokaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    FI9785_417 (gltX)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
360736..362235
Genome map
AA seq 499 aa AA seqDB search
MAKQKIRVRYAPSPTGHLHIGNARTALFNYLFARHNKGTMVLRIEDTDQKRNVEGGSKSQ
MENLHWLGIDWDEGPDKGGDFGPYRQSERKDIYNKYIQQLIDEGKAYYSYKTEEELEAQR
EEQRAMGIAPHYTYEYEGMTADEIKEAQAAAEAKGLKPVVRIHIPENRTYAWEDMVKGKV
SFESDTIGGDFVIQKRDGMPTYNFAVVIDDHLMEITHVLRGDDHVANTPKQLVVYEALGW
EPPKFGHMTLIINSETGKKLSKRDESVLQFIEQYRDLGYLPDAMFNFITLLGWSPVGESE
IFSQRELIKSFDPKRLSKSPAAFDQKKLEWINNQYVKKADRDLLLDLALNNLQEAGLVDK
EISPEKMEWVRQLVNIYAVQMSYTKQIVDIAKIFFEEAPELSDAEIEEIKKDDARPVIEE
FKKQLNAVPRFTAVQAMNAIQATRRETGVKGRKLFMPIRIAATRSMVGPGIGEAIELMGK
EKVNKHIDLTLKQLSDLGL
NT seq 1500 nt NT seq  +upstreamnt  +downstreamnt
ttggcaaaacaaaaaatccgcgttcgttacgcaccaagtccaacaggtcacttgcacatt
ggtaacgcacgtactgcattatttaactatctatttgcacgtcacaataaagggacaatg
gtcttaagaattgaagatacggaccaaaaacgtaacgttgaaggtggttctaagtcccaa
atggaaaacttgcactggttaggtattgactgggatgaaggtcctgataagggtggcgac
tttggcccttaccgccaatcagagcgtaaagacatttacaataaatatattcagcaatta
attgatgaaggtaaagcttactattcatacaagactgaggaagaacttgaagcacaacgt
gaagaacaacgtgcaatgggaattgctcctcactacacttatgaatatgaaggcatgacc
gctgatgaaattaaagaagctcaagcagctgcagaagcaaaaggcttaaagccagttgtt
cgtatccacattcctgaaaatagaacttatgcttgggaagatatggttaagggtaaggta
tcatttgaatcagatactatcggtggtgacttcgttattcaaaaacgtgatggtatgcca
acctacaacttcgccgttgtaattgatgaccacttaatggaaattactcacgttcttaga
ggggacgaccacgtagctaacactcctaagcaattagttgtttatgaagcacttggctgg
gaaccacctaagtttggtcacatgactttgatcattaactctgaaactggtaaaaaactt
tctaagcgtgatgaatcagttcttcaatttattgaacaataccgtgaccttggttactta
ccagacgcaatgttcaactttattaccttacttggctggtctcctgttggtgaaagtgaa
attttctcacaaagagaattaattaagtcatttgatcctaagcgtttatctaagtcacca
gctgcctttgaccaaaagaaacttgaatggattaacaaccaatacgttaagaaggcagac
cgtgatcttttattagatcttgctttgaataacttacaagaagcaggtttagttgataaa
gaaatttcaccagaaaagatggaatgggttcgtcaattagtaaatatttacgctgtacaa
atgtcttatactaagcaaattgtagatattgctaagatcttctttgaagaagctccagaa
ttatctgatgcagaaattgaagaaatcaagaaagacgatgctcgtcctgtaattgaagaa
ttcaagaagcaactaaatgctgttcctcgctttactgctgtacaagctatgaacgcaatt
caagctactcgtcgtgaaactggcgtaaagggtagaaaattatttatgccaattagaatt
gctgctactcgttcaatggttggacctggtattggtgaagctattgagttaatgggtaag
gaaaaagttaacaagcacattgacttaactttaaagcaattaagtgatttaggtctttaa

DBGET integrated database retrieval system