KEGG   Lactobacillus johnsonii FI9785: FI9785_509Help
Entry
FI9785_509        CDS       T01120                                 

Gene name
pepV
Definition
Beta-Ala-Xaa dipeptidase (EC:3.4.13.3)
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
ljf  Lactobacillus johnsonii FI9785
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:ljf00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    FI9785_509 (pepV)
  Amino acid metabolism
   00300 Lysine biosynthesis
    FI9785_509 (pepV)
Enzymes [BR:ljf01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     FI9785_509 (pepV)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(446474..447871)
Genome map
AA seq 465 aa AA seqDB search
MEELDYKKLAQEKKDAILNDLKELIAIDSSEDLNNTSKEYPVGPGPVKAMKKFLSFAKRD
GFDTENFDNYAGRINMGSGDKRVGIIGHMDVVPAGEGWKTDPFKMTIKDGKIYGRGSADD
KGPSLAAYYGMLILKEHGFKPKKKIDFVLGTNEETNWVGIDYYLKHQPAPDVAFSPDAEF
PIINGEQGIVTLKLDFKFDPSQGDVKLWTFQSGIATNVIPQTAHAQLEGDIDGIKEKFDL
FLKEHKLEGKAEMLSGRLALTLTGHGAHASAPETGRNAATYLALFLDSLNFDGQAKKFLH
FLATVEHKDFNGKKLGIFHHDDLMGDLTSSPSMFNFEGQNAYLLNNVRYPQGIEPEEMVK
NINEKFGDILDARIEGSAEAPHYVPGDDPIVKTLLSVYEKQTGKKGHEVIIGGGTYGRLF
KHGVAFGAQPEGSPLVMHQPNEYMKVDDLINSIAIYAEAIYELTK
NT seq 1398 nt NT seq  +upstreamnt  +downstreamnt
atggaagaactagattataaaaaattagctcaggaaaaaaaggacgctattttaaatgat
ttaaaagaattaatcgcaattgattcttctgaagatttaaacaacaccagtaaagaatac
ccagttggtcctggcccagttaaagcaatgaagaaatttttatcttttgctaaacgcgat
ggtttcgacactgaaaattttgataactatgcaggtcgaatcaatatgggttctggtgat
aaacgtgtaggtattattggacatatggatgttgttcctgctggcgaaggatggaagact
gatccatttaagatgactattaaagatggaaaaatctatggtcgtggtagtgctgatgat
aaaggaccttctttagctgcttactacggaatgcttatcttaaaggaacatggatttaag
cctaaaaaaaagattgattttgtccttggaactaatgaagaaactaattgggtaggaatt
gattactacctcaagcatcaaccagctcctgatgttgccttctcacctgatgctgaattt
ccaattatcaacggtgaacaaggaattgttactctaaagcttgacttcaaatttgaccca
agccaaggtgacgttaagctttggacattccaatccggtattgctactaacgtcatccct
caaaccgctcatgcccaacttgaaggcgatattgacggcattaaagaaaaatttgatctt
ttccttaaagaacataaacttgaaggtaaggctgaaatgcttagcggtcgccttgcctta
acattaactggtcatggcgctcatgcatcagctcctgaaactggtagaaatgctgctact
tatcttgccctcttccttgatagtcttaactttgatggccaagcaaagaaattcttacac
ttcctagcaactgttgaacataaagacttcaatggtaagaaattaggcattttccaccat
gacgatttaatgggtgatttaaccagttcaccaagtatgtttaattttgaaggtcaaaat
gcatacctcttaaacaatgttcgctatcctcaaggtattgaaccagaagaaatggtgaaa
aatatcaacgaaaagtttggtgatattttagatgctagaattgaaggctctgctgaagct
ccacactatgttcctggagatgatccaattgttaagacacttctttctgtttatgaaaaa
caaactggtaaaaagggacatgaggttatcattggtggtggtacatacggccgcctattc
aaacatggtgtagcctttggtgctcaaccagaaggttccccacttgttatgcaccaacca
aatgaatacatgaaagttgatgatttaattaattcaattgctatttatgccgaagcaatt
tatgaattaactaagtaa

DBGET integrated database retrieval system