KEGG   Lactobacillus johnsonii FI9785: FI9785_579Help
Entry
FI9785_579        CDS       T01120                                 

Gene name
glsA
Definition
hypothetical protein
Orthology
K01425  
glutaminase [EC:3.5.1.2]
Organism
ljf  Lactobacillus johnsonii FI9785
Pathway
Alanine, aspartate and glutamate metabolism
Arginine and proline metabolism
D-Glutamine and D-glutamate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ljf00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    FI9785_579 (glsA)
   00330 Arginine and proline metabolism
    FI9785_579 (glsA)
  Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    FI9785_579 (glsA)
Enzymes [BR:ljf01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.2  glutaminase
     FI9785_579 (glsA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
516237..517157
Genome map
AA seq 306 aa AA seqDB search
MIQLEELVKKNLLKEKEGKVASYIPALAEVNPEQLGVALYDLDDGEIGEAGQSEVRFAIE
SISKVITLMLAIKKMGIQEVFNHVGSRQSGFAFDSILNMEIEKAKYPLNPFINAGAIATT
SMVVSKTGEGAFEEILSFARDICNDPNLYLDQIIYHSERRTGNFDRSLAYYMESKNMLLG
DVITSLDTYFKQCSMMVTARSLANLGAVLANNGVKPWDGKRIISVEGARCIKSLMMTTGL
YNQSGTYSRLIGVPTKSGVGGGLMSAAPHRYGIGIFSPALDKAGNSVAGLELLKDIVEDL
ELDIFD
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atgattcaattagaagaattggttaagaaaaatttactcaaagaaaaagaaggaaaagtt
gctagttatattccagctttagctgaagttaatcctgaacaattaggcgtagctttgtat
gacttagatgatggtgaaattggtgaagcgggacaaagtgaagtaagatttgcgattgag
agtatttctaaggtaattactttgatgcttgccattaaaaagatgggaattcaagaagtg
tttaaccatgttggatctcgtcaaagtggatttgcctttgactcgattttaaatatggaa
attgaaaaagcaaagtacccgctaaatccttttatcaatgctggtgcaattgctacaact
tcgatggttgtaagtaaaaccggtgaaggagcgtttgaagaaattctttcttttgctcgt
gatatttgcaatgatcctaatctttacttggatcaaataatttatcattcagaaagaaga
actggtaattttgatcgttcacttgcctattatatggaatcgaagaatatgttattagga
gatgttataacaagcctcgatacttactttaagcaatgttcaatgatggttactgcacgc
tccttggcaaacttaggtgctgttcttgctaataacggcgtaaaaccttgggatggaaag
cgaattatttctgttgaaggagcaagatgtattaagtcattgatgatgacaacgggactt
tataatcagtcaggaacttattcccgtttaattggtgtgccaactaaaagcggagttggt
ggcggtttaatgtcagctgcaccacatagatatgggattggaatttttagtcctgcactt
gataaggctggcaatagtgttgctggattagagttattaaaggatattgttgaagactta
gagctagatatttttgattaa

  All links  
No link information was found.   
DBGET integrated database retrieval system