KEGG   Lactobacillus johnsonii FI9785: FI9785_583Help
Entry
FI9785_583        CDS       T01120                                 

Gene name
melA
Definition
alpha-galactosidase, melibiase (EC:3.2.1.22)
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
ljf  Lactobacillus johnsonii FI9785
Pathway
Galactose metabolism
Glycerolipid metabolism
Brite
KEGG Orthology (KO) [BR:ljf00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    FI9785_583 (melA)
  Lipid metabolism
   00561 Glycerolipid metabolism
    FI9785_583 (melA)
   00600 Sphingolipid metabolism
    FI9785_583 (melA)
Enzymes [BR:ljf01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     FI9785_583 (melA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
522133..524295
Genome map
AA seq 720 aa AA seqDB search
MLKIDNQNSRIRFHLSNKKISYVLEVIDKKFIVNRYIGPKLPYFSGSSNLDQGRHAFAVY
QKGDDFSASNLPLEYSISQSGDYRETSAEITDKHRMPLINLKYKGYNQEKVEMPDLPHIR
NAKGSSLNIQLVSQNDYLSITLHYFLFDDLPSIVRWISYKNIGKSIIHLDKTDSLQLDLP
NRDWKTLSFYGTHANEFVPSIKPIFEGKMEINSKRGSSSPQHQPFMAIIDNNFSLNTGKF
ISCSLMWSGNFRISVENDQSNYIRLNAGIGGDLFDISLHPSEKFVTPQAILSLGHKGLGE
MCSISQQLIRDHILESRINYPLIAFNTWEMSYFAVNEEKCIKALHQAKKIGANLLVIDDG
WFNNRNSENGQLGDWIPDENKFPHGLKFISNLTHREDMKFGIWVEPEMVTTSSNLFKLHP
DWVLGLENIDTALYSRDQLVLDLSKKEVQDHIIKTISNLIVKNQIDYLKWDFNRQLAPIF
SQGRGASEQGKISYGYILGLYRVLNTLRNKFKDLIIENCAAGGGRIDPGMVYFTDQTWIS
DLTDALGRFRIMDSMSTIYPIQIFSSHFSKSPNEQDGRILPMQTRLRLSSVGSLGFELDL
SLMNEDKINQIKSYVEKYKKDYDLFHDAICLPLTFLQKSATMPIAILLKGIRRSLVIYSY
GATNAIHQPKWLPVIFLDNDKNYLVDEKNIYSGVELNNAGLTIPPVMGDFKVNTYLLEIK
NT seq 2163 nt NT seq  +upstreamnt  +downstreamnt
atgttaaaaatagataatcaaaattcacggataagattccatttatctaataagaaaatt
tcatatgtactagaggtaatagataaaaaattcatagtaaatagatatattggtcctaaa
ctaccatatttttcaggaagttcaaatttagatcagggcagacatgcatttgctgtttat
caaaaaggagatgacttttcagcttctaatttacctttagagtatagtatttcacaatca
ggagattatagagaaacaagtgcggaaattaccgataagcaccgtatgccattgattaat
ttaaaatataagggatataatcaagaaaaagtagaaatgcccgatttaccccatattaga
aatgctaaagggagtagtttaaatatacagcttgtaagtcaaaatgattatttatccatt
accctacattattttttatttgatgatttgcctagtatagttcgctggatttcatataag
aatattggaaaatctattattcatttggataaaacagatagtttgcagttagatttaccc
aatagagattggaaaacattaagtttttatggaacacacgcaaatgaatttgtaccttca
ataaaaccaatttttgaaggtaaaatggagatcaatagtaaaaggggaagtagtagtcca
caacatcaaccatttatggcaataattgataataatttttcattgaacactggaaaattt
attagttgtagtctgatgtggagcggaaactttagaattagtgttgagaatgatcaaagt
aattatattagattaaatgctggcattggtggtgatctatttgatatatctttgcatcca
tcagaaaaatttgtaactccacaagcgattttatcattgggacataagggattaggcgaa
atgtgtagtatttctcaacaattaattcgagatcatattcttgaatctagaattaattat
cctttgattgcatttaatacctgggaaatgtcatattttgctgttaatgaagaaaaatgt
attaaagctcttcatcaagctaaaaaaataggggctaatttattagtaattgatgatgga
tggtttaataatagaaactccgaaaatggtcagcttggagattggattccagatgagaat
aaatttccacatggattgaaatttatttctaatttaacacatagagaagatatgaagttt
ggaatatgggtagaaccagagatggttactacttcaagtaatttatttaagttacatcct
gattgggtattaggtttagagaatattgatacagcattatatagcagagatcaacttgtt
ttagatttaagtaaaaaagaagttcaagatcatattattaaaacgattagtaacttaatt
gttaaaaatcaaattgattatttaaaatgggattttaatagacaacttgcaccaattttt
agtcagggacggggagcatctgaacaaggtaaaattagttatggatatatattaggattg
tatagagtgttaaatactctgagaaataaattcaaggacttgattattgaaaattgcgct
gctggaggcggtagaatagatccaggaatggtatattttacggatcaaacttggattagt
gatttaactgatgctttaggtcgatttagaataatggatagtatgagtactatttatcca
attcaaatattttcatcacatttttcaaagtctccaaatgaacaggatggaagaatatta
ccgatgcaaacaagactgaggttatcatcagtaggatctctaggatttgaattagactta
agtttaatgaatgaagataaaattaaccaaattaagtcttatgtggaaaaatataaaaaa
gactatgatctgtttcatgatgcaatttgtttgccgttaacgttcttacagaagagtgct
acgatgccaatagcaattttattaaagggaattagaagaagtttagttatatactcatat
ggtgctacaaatgcaattcatcagccgaaatggctaccagttatatttttagataatgat
aaaaattatctagttgatgaaaaaaatatttattcaggagttgagttaaataatgccggt
ttaactattcctccagtcatgggtgattttaaggtaaatacgtatttgttagaaataaaa
tag

DBGET integrated database retrieval system