KEGG   Lactobacillus johnsonii FI9785: FI9785_609Help
Entry
FI9785_609        CDS       T01120                                 

Definition
hypothetical protein
Orthology
K12308  
beta-galactosidase [EC:3.2.1.23]
Organism
ljf  Lactobacillus johnsonii FI9785
Pathway
Galactose metabolism
Brite
KEGG Orthology (KO) [BR:ljf00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    FI9785_609
Enzymes [BR:ljf01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     FI9785_609
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
539215..539721
Genome map
AA seq 168 aa AA seqDB search
MNGHVILATPSGARPAWLAQKYPEVLRTDNRGNKRGFGGRHNHCLTSPIYRKKVYEINTK
LAEHFGQRKSLVLWHISNEYSGECYCDLCKDAFRKWLKNKYGDLATLNHARWNTFWSHTY
NDWDQVNQPSPLSEMGNKGMSLDWKRFITDQTISFIDNETAPLKKDHS
NT seq 507 nt NT seq  +upstreamnt  +downstreamnt
atgaatggtcatgtaattttagctacgccaagtggagcacgaccagcgtggcttgctcaa
aagtatccagaagtccttagaacagataaccggggaaataaacgcggctttggtggacga
cataatcattgtttaacttcacctatttatcgaaaaaaagtttatgagattaacacaaaa
ctggcagaacattttggtcaaaggaaaagtttggtgctttggcatatttctaatgaatat
tcaggtgaatgctactgcgatttatgtaaagatgcttttagaaaatggctgaaaaataag
tatggcgatctagctactttaaatcatgcccggtggaacactttttggagtcatacttat
aatgactgggatcaagttaatcagcctagtcctttaagtgaaatgggtaataaaggaatg
agcttagactggaagagatttattactgaccagacaatttcatttattgataatgaaaca
gcaccccttaaaaaagatcactcctaa

DBGET integrated database retrieval system