KEGG   Lactobacillus johnsonii FI9785: FI9785_658Help
Entry
FI9785_658        CDS       T01120                                 

Definition
putative phosphoketolase (EC:4.1.2.-)
Orthology
K01621  
phosphoketolase [EC:4.1.2.9]
Organism
ljf  Lactobacillus johnsonii FI9785
Pathway
Pentose phosphate pathway
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:ljf00030]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
580329..582734
Genome map
AA seq 801 aa AA seqDB search
MAVNYNSQEYLKSVDAYWRAANYLSVGQLFLMNNPLLKRDLKAEDVKPKPIGHWGTIVPQ
NFIYAHLNRAIKKYDLNMFYIEGSGHGGQVMVSNSYLDGSYTERYPEITQDEKGMAKLFK
QFSFPGGVASHAAPETPGSIHEGGELGYSLSHGVGAILDNPDVIAAVEIGDGESETGPLA
TSWFSSKFINPIKDGAVIPILQINGFKISNPTIVSRMSDEDLTKYFEGMGWKPYFVSAYK
DGEFNGYKDHMEVHQEMAKTMDEVVEEIKAIQKHARENKDDSLVKWPMIVFRVPKGWTGP
KFDLDGNPIENSFRAHQIPIPVAQDDMAHKEMLTDWMESYKPEELFNEDGSPKDIVKENT
LSGDQRMAMNPVTNGGIDPKVLNMPDYRDFAIKFDKPGSVEKQDMAEWAKYLDKMSELNP
TNFRGFGPDETKSNRLFQLLDNQKRQWMQNIHTPNDENLAHEGRVIDSQLSEHQDEGWLE
GYVLTGRHGFFATYEAFGRVVDSMLTQHMKWLRKAKEQPWRHDYPALNLVDTSTVFQQDH
NGYTHQDPGMLTHLYEKNRPDLIHEYLPADTNSLLAVSDKAFRDRECINVLVTSKQPRPQ
WFSIEEAKKLVDKGLGYVDWASTDKGAKPDVVFASTGTEPTIESLAAIDLLHKKFPDLKI
RYINVIDVMKLMSPEKNPNAISNEEFNRLFPKDTPVIFAWHGFKPMMESIWFDRGRGKDD
VHIHGYEENGDITTPFDMRVLNHMDRYDLAKDVVESIPELNEKNADFIDEMDSLLAKHHQ
YIRDNGKDMPEVTEWQWNCLE
NT seq 2406 nt NT seq  +upstreamnt  +downstreamnt
atggcagtaaattacaattctcaagaatacttaaagagtgttgacgcatactggcgtgca
gctaactacttatcagtaggacaattatttttaatgaataaccctttacttaagagagac
ttaaaggcagaagatgtaaaacctaagccaattggtcactggggtacaattgtgccacaa
aactttatctatgctcatttaaatcgtgcaattaagaaatatgatttaaatatgttctac
attgagggttctggtcatggtggccaagtaatggtatctaattcatacttagatggttca
tatactgagcgctacccagaaatcactcaagatgaaaagggaatggcgaagttatttaag
caatttagtttcccaggtggcgttgcttctcatgctgctccagaaactcctggatcaatt
catgaaggtggagaattaggttactcactatctcatggtgttggtgcaattttagataat
ccggatgtaattgctgcagttgaaattggtgatggtgaatcagagactggtccacttgct
acttcttggttttcaagtaaattcattaatccaattaaagatggtgcagttattcctatc
ttgcaaattaatggctttaagatttctaatccaactatcgtttctagaatgagtgatgaa
gacttaactaagtactttgaaggaatgggttggaagccatactttgtttctgcatataaa
gacggtgaatttaatggttataaagaccacatggaagttcaccaagaaatggccaagaca
atggatgaagttgttgaagagattaaggctattcaaaagcatgctcgtgaaaataaagat
gattccttagtgaagtggccaatgattgtctttagagtacctaagggctggactggtcca
aaatttgatctagatggcaacccaattgaaaatagtttccgtgctcaccaaattccaatt
cctgttgctcaagatgacatggctcataaagaaatgcttactgattggatggaaagttat
aagccagaagaattattcaatgaagatggctcaccaaaagatatcgttaaagaaaatacc
ttatcaggcgaccaaagaatggctatgaatccagtaaccaatggtggtattgatccaaaa
gtcttaaatatgcctgactaccgcgactttgcaattaaatttgataagcctggatctgtt
gaaaaacaagatatggccgaatgggcaaaatatttagacaagatgtctgaattgaaccca
actaatttccgtggttttggccctgatgaaactaaatctaatcgtttattccaactttta
gataatcaaaaacgtcaatggatgcaaaatattcatactccaaacgatgaaaacttggct
cacgaaggtcgtgtgattgactcacaattgtcagaacaccaagatgaaggttggcttgaa
ggatatgtattaaccggtcgtcacggattctttgctacatatgaagcatttggacgtgta
gttgattcaatgttgactcaacatatgaagtggttaagaaaagctaaggaacaaccttgg
agacatgattatccagccttgaacttagttgatacttcaactgttttccagcaagatcat
aatggttatactcaccaagatcccggtatgttaactcatttgtatgaaaagaatcgtcca
gatttaattcacgaatacttgccagcagatactaactcccttcttgctgtatctgataag
gcatttagagatcgtgaatgtatcaatgttttagtaacttctaaacaacctcgtcctcag
tggttctcaattgaagaagctaagaaattagttgataaaggtcttggctatgttgactgg
gcatcaactgataagggcgctaagccagatgttgtttttgcttcaactggtactgaacca
acaattgaatctttagctgccattgatttacttcataagaaattcccagacttaaagatt
cgctatattaatgtcattgatgttatgaagttaatgtctccagaaaagaatccaaatgcg
atcagtaatgaagaattcaatcgtcttttccctaaagatacgccagttatctttgcatgg
catggatttaagccaatgatggaatcaatttggtttgatcgcggtcgtggtaaagatgat
gtgcatattcatgggtatgaagagaatggtgacattaccactccttttgatatgcgtgtt
ttaaaccacatggatcgctatgacttagcaaaagatgtagtagaaagtattcctgagcta
aatgaaaagaatgcagatttcattgatgaaatggatagcttgcttgctaaacatcaccaa
tatatccgtgataacggtaaagatatgcctgaagttactgaatggcaatggaattgctta
gaataa

DBGET integrated database retrieval system