KEGG   Lactobacillus johnsonii FI9785: FI9785_672Help
Entry
FI9785_672        CDS       T01120                                 

Gene name
galU
Definition
UTP-glucose-1-phosphate uridylyltransferase (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
ljf  Lactobacillus johnsonii FI9785
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ljf00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    FI9785_672 (galU)
   00052 Galactose metabolism
    FI9785_672 (galU)
   00500 Starch and sucrose metabolism
    FI9785_672 (galU)
   00520 Amino sugar and nucleotide sugar metabolism
    FI9785_672 (galU)
Enzymes [BR:ljf01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     FI9785_672 (galU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
595879..596784
Genome map
AA seq 301 aa AA seqDB search
MKVRKAVIPAAGLGTRFLPATKAMPKEMVPIVDKPTIQFIVEEAKKSGIEDILIVTGKNK
RSIEDHFDANPELEQDLEEKGKTDLLHLTQSITNLGVNLYYTRQPHPAGLGDAILRARSF
VGDEPFAVMLGDDLMDDKVPLTKQLIDRYDKTHASTIAVMPVPHEEVSKYGVIDPDSEIE
PGLINVKAFVEKPDIDKAPSDYAIIGRYLLTPEIFDILAHQKPGRGGEIQLTDAIDTMNK
TQRVFAHVFNGERHDVGNKEGYLETSIEYGLSHPQIKDDLREYIINMAQKLQKEGKNSKK
K
NT seq 906 nt NT seq  +upstreamnt  +downstreamnt
atgaaagtaagaaaagcagttattccagcagctggattaggtactaggtttttacctgcc
actaaggctatgcctaaggaaatggtaccgattgttgataaaccaacaattcaatttatt
gtagaagaagctaaaaaatctggaattgaagatatcttgatcgttactggtaaaaacaag
cgttctatcgaagatcactttgatgctaacccagaactagaacaagatttggaagaaaag
ggtaagactgatcttttacacttaacccaatcaattactaacttaggtgttaacctttac
tacactcgtcaaccacacccagctggtttaggagatgcgattttaagagctcgtagcttc
gttggggatgaaccatttgctgttatgcttggtgacgacttgatggatgacaaggttcca
ctaactaagcaattgatcgatcgttatgacaagactcatgcatcaactattgctgttatg
cctgtaccacatgaagaagtttctaagtatggtgttattgatccagatagcgaaattgaa
cctggtttaattaacgttaaggcctttgttgaaaagccagacattgataaggcacctagt
gactacgcaattattggtcgttacttgttaactccagaaatttttgatattttagcacat
caaaaacctggtcgtggtggcgaaattcaattaactgacgcaattgatactatgaacaag
actcaacgagtattcgctcatgtatttaatggtgaacgtcatgatgttggtaacaaggaa
ggttaccttgaaacatcaattgaatatggtttatctcaccctcaaattaaagatgattta
cgtgagtacattattaacatggctcaaaaattacaaaaagaaggtaaaaactcaaagaag
aaataa

DBGET integrated database retrieval system